BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0823 (742 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 09_02_0043 - 3444713-3444811,3445077-3445137,3446042-3446090,344... 32 0.55 03_06_0074 - 31476094-31476215,31477803-31478238,31478438-314784... 31 1.3 06_03_0256 - 18841627-18841993,18842087-18842415,18842512-188427... 29 3.9 09_06_0280 + 22010270-22011407,22011890-22013097 29 5.1 01_06_1355 + 36610390-36610479,36611906-36612063,36612144-366125... 29 5.1 11_01_0597 + 4769748-4770166,4770263-4770545,4770725-4771360 28 6.8 02_05_0246 + 27136590-27138610,27138933-27139056,27139401-271396... 28 6.8 01_01_0827 + 6443319-6446085,6446317-6446407,6446502-6448017,644... 28 6.8 06_01_0606 - 4382133-4382704,4383017-4383336,4384152-4384258,438... 28 9.0 04_04_0371 + 24771687-24772081,24772139-24772535,24773394-247734... 28 9.0 01_06_1078 + 34378985-34380064,34380155-34380283,34380362-343804... 28 9.0 01_06_0061 - 26071984-26072343,26072792-26073139,26073228-260733... 28 9.0 >09_02_0043 - 3444713-3444811,3445077-3445137,3446042-3446090, 3446703-3447054,3448231-3448359,3449550-3449555 Length = 231 Score = 31.9 bits (69), Expect = 0.55 Identities = 15/54 (27%), Positives = 32/54 (59%) Frame = +2 Query: 374 VFGFLSVDGEDTRRLFFHMSEVRGNPSELQSGDTVEFVMLTNPRNGKSSACNVV 535 ++G+++V + + L + ++ R NP ++ GD +E +T P+ G S C+V+ Sbjct: 15 LYGYIAVRDDLDKLLNYVVNYSRDNPIIMRQGDLIE---MTGPKRGISMCCSVL 65 >03_06_0074 - 31476094-31476215,31477803-31478238,31478438-31478485, 31478569-31479018,31479567-31479681,31480052-31480905 Length = 674 Score = 30.7 bits (66), Expect = 1.3 Identities = 19/60 (31%), Positives = 26/60 (43%) Frame = -2 Query: 216 PPST*IKPEYWA*SGFRARKVLVTVPFRVGSSGFAIGIVPRAKTRTYSALAQPPPEPFRR 37 PPS+ KP + R L T+P +G A +TRT ++ PPP P R Sbjct: 36 PPSSSRKPPLPPRRSPQKRPGLPTIPENGPPAGMATATATPKRTRTPTSTCAPPPPPHAR 95 >06_03_0256 - 18841627-18841993,18842087-18842415,18842512-18842749, 18844091-18844373,18844773-18844989,18845067-18845360 Length = 575 Score = 29.1 bits (62), Expect = 3.9 Identities = 15/48 (31%), Positives = 26/48 (54%) Frame = -2 Query: 501 GLVSITNSTVSPDCNSEGLPRTSDMWKNKRRVSSPSTDKKPKTPFMAS 358 G+V++TN+ +S D ++ M ++KR V+ P P +P AS Sbjct: 158 GIVNLTNTVLSDDVSNPSTQSAETMGRSKREVAPP----PPPSPSQAS 201 >09_06_0280 + 22010270-22011407,22011890-22013097 Length = 781 Score = 28.7 bits (61), Expect = 5.1 Identities = 17/54 (31%), Positives = 25/54 (46%) Frame = -1 Query: 469 PRLQLGGITSNLRHVEEQTTSIFAVDRQKAKNTFYGVNNGTSLLSNWHYVTGPS 308 PRL +G T + + +++ AVD A N Y V +GT+ W V S Sbjct: 77 PRLMIGNSTLQVVSISLANSTLRAVDIAGAVNITYDVVSGTTGNGTWGGVAATS 130 >01_06_1355 + 36610390-36610479,36611906-36612063,36612144-36612523, 36612600-36613583,36614228-36614292,36614946-36615024, 36615480-36615529,36616595-36616781,36617922-36617957, 36619226-36619348,36619466-36620386,36620506-36620636 Length = 1067 Score = 28.7 bits (61), Expect = 5.1 Identities = 13/29 (44%), Positives = 18/29 (62%), Gaps = 1/29 (3%) Frame = -1 Query: 658 AAWS-AHSNHSRPCRLLQRSRPEPREKPL 575 +AW A NH+ P +LQ + P+P KPL Sbjct: 567 SAWFWASGNHADPAHILQLASPDPIFKPL 595 >11_01_0597 + 4769748-4770166,4770263-4770545,4770725-4771360 Length = 445 Score = 28.3 bits (60), Expect = 6.8 Identities = 12/23 (52%), Positives = 13/23 (56%) Frame = +1 Query: 64 CKR*IRPCFGSRYYTYCEAARTN 132 C R PC G R YTY +A R N Sbjct: 85 CYRSGDPCTGKRNYTYMDAVRAN 107 >02_05_0246 + 27136590-27138610,27138933-27139056,27139401-27139694, 27139776-27139978,27140307-27140589 Length = 974 Score = 28.3 bits (60), Expect = 6.8 Identities = 16/30 (53%), Positives = 18/30 (60%) Frame = -2 Query: 135 RVGSSGFAIGIVPRAKTRTYSALAQPPPEP 46 R SS A G + RAKTR S L PPP+P Sbjct: 264 RCTSSSTAAGHLMRAKTR--SRLMDPPPQP 291 >01_01_0827 + 6443319-6446085,6446317-6446407,6446502-6448017, 6448164-6448243,6449045-6449129,6449221-6449312, 6449388-6449456,6449544-6449580,6449662-6449744, 6450427-6450873,6450978-6451014,6451101-6451158, 6451243-6451382,6451610-6451675,6451794-6451908, 6453261-6453299,6453482-6453543 Length = 1927 Score = 28.3 bits (60), Expect = 6.8 Identities = 15/32 (46%), Positives = 20/32 (62%) Frame = -2 Query: 525 QAEDFPLRGLVSITNSTVSPDCNSEGLPRTSD 430 +AED L G+VS NST+S +S+ L SD Sbjct: 1069 EAEDGSLEGVVSSENSTISSQNSSDYLFHMSD 1100 >06_01_0606 - 4382133-4382704,4383017-4383336,4384152-4384258, 4384339-4384512,4384956-4385204,4386831-4386986 Length = 525 Score = 27.9 bits (59), Expect = 9.0 Identities = 11/27 (40%), Positives = 16/27 (59%) Frame = -1 Query: 631 SRPCRLLQRSRPEPREKPLWTFTSHFT 551 +RP + + P+PR+ LW TS FT Sbjct: 195 ARPPLFFKETDPQPRKHTLWQATSDFT 221 >04_04_0371 + 24771687-24772081,24772139-24772535,24773394-24773435, 24773571-24774305,24775357-24775480,24775613-24776580, 24776917-24776925 Length = 889 Score = 27.9 bits (59), Expect = 9.0 Identities = 10/40 (25%), Positives = 22/40 (55%) Frame = -1 Query: 508 ITRISKHHELNSIPRLQLGGITSNLRHVEEQTTSIFAVDR 389 + RI +HH ++ P ++ + +L+ ++ S+ VDR Sbjct: 570 LKRICRHHGISRWPSRKINKVNRSLKKIQTVINSVHGVDR 609 >01_06_1078 + 34378985-34380064,34380155-34380283,34380362-34380430, 34380536-34380588,34381309-34381421,34381565-34382132, 34382520-34382580,34382624-34382665 Length = 704 Score = 27.9 bits (59), Expect = 9.0 Identities = 13/31 (41%), Positives = 17/31 (54%) Frame = +1 Query: 604 FVGGVGRASSDCCAHSTRPRRIERLPSASSH 696 F G G+ S DCC H TR ++ S +SH Sbjct: 646 FGGEEGKESKDCC-HITREKKNREFKSDTSH 675 >01_06_0061 - 26071984-26072343,26072792-26073139,26073228-26073371, 26073454-26073723,26075019-26075825 Length = 642 Score = 27.9 bits (59), Expect = 9.0 Identities = 15/48 (31%), Positives = 22/48 (45%), Gaps = 1/48 (2%) Frame = +2 Query: 35 GRLNGSGGGCA-SAEYVRVLARGTIPIAKPLEPTLNGTVTRTLRALNP 175 G G GGG + A+ A G +P A+P G +TL+ + P Sbjct: 77 GASGGGGGGVSCGAQPAAAAAAGAVPAAQPEGKKFLGVEVKTLKKIVP 124 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 22,097,833 Number of Sequences: 37544 Number of extensions: 487906 Number of successful extensions: 1925 Number of sequences better than 10.0: 12 Number of HSP's better than 10.0 without gapping: 1838 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1923 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1957111448 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -