BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0823 (742 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ535203-1|CAD59403.1| 1229|Anopheles gambiae SMC1 protein protein. 26 1.1 M93691-2|AAA29365.1| 1222|Anopheles gambiae protein ( Anopheles ... 25 1.9 DQ004399-1|AAY21238.1| 847|Anopheles gambiae lysozyme c-6 protein. 25 3.2 DQ080909-1|AAY89555.1| 120|Anopheles gambiae olfactory receptor... 24 4.3 DQ080908-1|AAY89554.1| 120|Anopheles gambiae olfactory receptor... 24 4.3 DQ080907-1|AAY89553.1| 120|Anopheles gambiae olfactory receptor... 24 4.3 DQ080906-1|AAY89552.1| 120|Anopheles gambiae olfactory receptor... 24 4.3 DQ080905-1|AAY89551.1| 120|Anopheles gambiae olfactory receptor... 24 4.3 DQ080904-1|AAY89550.1| 120|Anopheles gambiae olfactory receptor... 24 4.3 DQ080903-1|AAY89549.1| 120|Anopheles gambiae olfactory receptor... 24 4.3 DQ080902-1|AAY89548.1| 120|Anopheles gambiae olfactory receptor... 24 4.3 DQ080901-1|AAY89547.1| 120|Anopheles gambiae olfactory receptor... 24 4.3 DQ080900-1|AAY89546.1| 120|Anopheles gambiae olfactory receptor... 24 4.3 DQ080899-1|AAY89545.1| 120|Anopheles gambiae olfactory receptor... 24 4.3 DQ080898-1|AAY89544.1| 120|Anopheles gambiae olfactory receptor... 24 4.3 DQ080897-1|AAY89543.1| 120|Anopheles gambiae olfactory receptor... 24 4.3 DQ080896-1|AAY89542.1| 120|Anopheles gambiae olfactory receptor... 24 4.3 DQ080895-1|AAY89541.1| 120|Anopheles gambiae olfactory receptor... 24 4.3 DQ080894-1|AAY89540.1| 120|Anopheles gambiae olfactory receptor... 24 4.3 DQ080893-1|AAY89539.1| 120|Anopheles gambiae olfactory receptor... 24 4.3 DQ080892-1|AAY89538.1| 120|Anopheles gambiae olfactory receptor... 24 4.3 DQ080891-1|AAY89537.1| 120|Anopheles gambiae olfactory receptor... 24 4.3 DQ080890-1|AAY89536.1| 120|Anopheles gambiae olfactory receptor... 24 4.3 DQ080889-1|AAY89535.1| 120|Anopheles gambiae olfactory receptor... 24 4.3 DQ080888-1|AAY89534.1| 120|Anopheles gambiae olfactory receptor... 24 4.3 DQ080887-1|AAY89533.1| 120|Anopheles gambiae olfactory receptor... 24 4.3 DQ080886-1|AAY89532.1| 120|Anopheles gambiae olfactory receptor... 24 4.3 DQ080885-1|AAY89531.1| 120|Anopheles gambiae olfactory receptor... 24 4.3 DQ080884-1|AAY89530.1| 120|Anopheles gambiae olfactory receptor... 24 4.3 DQ080883-1|AAY89529.1| 120|Anopheles gambiae olfactory receptor... 24 4.3 DQ080882-1|AAY89528.1| 120|Anopheles gambiae olfactory receptor... 24 4.3 DQ080881-1|AAY89527.1| 120|Anopheles gambiae olfactory receptor... 24 4.3 DQ080880-1|AAY89526.1| 120|Anopheles gambiae olfactory receptor... 24 4.3 DQ080879-1|AAY89525.1| 120|Anopheles gambiae olfactory receptor... 24 4.3 DQ080878-1|AAY89524.1| 120|Anopheles gambiae olfactory receptor... 24 4.3 DQ080877-1|AAY89523.1| 120|Anopheles gambiae olfactory receptor... 24 4.3 DQ080876-1|AAY89522.1| 120|Anopheles gambiae olfactory receptor... 24 4.3 DQ080875-1|AAY89521.1| 120|Anopheles gambiae olfactory receptor... 24 4.3 DQ080874-1|AAY89520.1| 120|Anopheles gambiae olfactory receptor... 24 4.3 DQ080873-1|AAY89519.1| 120|Anopheles gambiae olfactory receptor... 24 4.3 DQ080872-1|AAY89518.1| 120|Anopheles gambiae olfactory receptor... 24 4.3 DQ080871-1|AAY89517.1| 120|Anopheles gambiae olfactory receptor... 24 4.3 DQ080870-1|AAY89516.1| 120|Anopheles gambiae olfactory receptor... 24 4.3 DQ080869-1|AAY89515.1| 120|Anopheles gambiae olfactory receptor... 24 4.3 DQ080868-1|AAY89514.1| 120|Anopheles gambiae olfactory receptor... 24 4.3 DQ080867-1|AAY89513.1| 120|Anopheles gambiae olfactory receptor... 24 4.3 DQ080866-1|AAY89512.1| 120|Anopheles gambiae olfactory receptor... 24 4.3 DQ080865-1|AAY89511.1| 120|Anopheles gambiae olfactory receptor... 24 4.3 DQ080864-1|AAY89510.1| 120|Anopheles gambiae olfactory receptor... 24 4.3 DQ080863-1|AAY89509.1| 120|Anopheles gambiae olfactory receptor... 24 4.3 DQ080862-1|AAY89508.1| 120|Anopheles gambiae olfactory receptor... 24 4.3 AJ438610-4|CAD27476.1| 593|Anopheles gambiae putative transcrip... 24 4.3 AY545988-1|AAS99341.1| 423|Anopheles gambiae carboxypeptidase B... 24 5.7 AY070257-1|AAL59656.1| 217|Anopheles gambiae glutathione S-tran... 24 5.7 AJ627286-1|CAF28572.1| 423|Anopheles gambiae carboxypeptidase B... 24 5.7 AJ441131-7|CAD29636.1| 1977|Anopheles gambiae putative Tyr/Ser/T... 24 5.7 AJ439398-6|CAD28129.1| 1978|Anopheles gambiae putative Tyr/Ser/T... 24 5.7 AY056833-1|AAL23627.1| 1253|Anopheles gambiae chitin synthase pr... 23 7.5 AY553322-1|AAT36323.1| 426|Anopheles gambiae G-protein coupled ... 23 9.9 >AJ535203-1|CAD59403.1| 1229|Anopheles gambiae SMC1 protein protein. Length = 1229 Score = 26.2 bits (55), Expect = 1.1 Identities = 14/33 (42%), Positives = 20/33 (60%), Gaps = 1/33 (3%) Frame = -1 Query: 559 HFTLAR-YFNDIASRRLPITRISKHHELNSIPR 464 HF L + Y N+ ++RL +ISK ELN I + Sbjct: 232 HFQLFKLYHNEKEAKRLKEDQISKQQELNIIEK 264 >M93691-2|AAA29365.1| 1222|Anopheles gambiae protein ( Anopheles gambiae RT2 retroposon. ). Length = 1222 Score = 25.4 bits (53), Expect = 1.9 Identities = 10/16 (62%), Positives = 11/16 (68%) Frame = -3 Query: 620 PTPPTKPSGAEREAAL 573 PTPP P A+R AAL Sbjct: 1132 PTPPASPRTAQRRAAL 1147 >DQ004399-1|AAY21238.1| 847|Anopheles gambiae lysozyme c-6 protein. Length = 847 Score = 24.6 bits (51), Expect = 3.2 Identities = 13/40 (32%), Positives = 19/40 (47%) Frame = -1 Query: 121 RLRNRYSTSSQNTDVFSACTAPARAVQATQTILDFDAQFQ 2 RLR ST+++++ S T V T DF+ FQ Sbjct: 806 RLRATESTATESSSTLSTVTTTLPPVVTTARFSDFNRWFQ 845 >DQ080909-1|AAY89555.1| 120|Anopheles gambiae olfactory receptor 38 protein. Length = 120 Score = 24.2 bits (50), Expect = 4.3 Identities = 8/24 (33%), Positives = 18/24 (75%) Frame = +2 Query: 137 NGTVTRTLRALNPDQAQYSGLIQV 208 NG++ T+ ++ P A++SGL+++ Sbjct: 74 NGSLIETIESICPTVARFSGLLRM 97 >DQ080908-1|AAY89554.1| 120|Anopheles gambiae olfactory receptor 38 protein. Length = 120 Score = 24.2 bits (50), Expect = 4.3 Identities = 8/24 (33%), Positives = 18/24 (75%) Frame = +2 Query: 137 NGTVTRTLRALNPDQAQYSGLIQV 208 NG++ T+ ++ P A++SGL+++ Sbjct: 74 NGSLIETIESICPTVARFSGLLRM 97 >DQ080907-1|AAY89553.1| 120|Anopheles gambiae olfactory receptor 38 protein. Length = 120 Score = 24.2 bits (50), Expect = 4.3 Identities = 8/24 (33%), Positives = 18/24 (75%) Frame = +2 Query: 137 NGTVTRTLRALNPDQAQYSGLIQV 208 NG++ T+ ++ P A++SGL+++ Sbjct: 74 NGSLIETIESICPTVARFSGLLRM 97 >DQ080906-1|AAY89552.1| 120|Anopheles gambiae olfactory receptor 38 protein. Length = 120 Score = 24.2 bits (50), Expect = 4.3 Identities = 8/24 (33%), Positives = 18/24 (75%) Frame = +2 Query: 137 NGTVTRTLRALNPDQAQYSGLIQV 208 NG++ T+ ++ P A++SGL+++ Sbjct: 74 NGSLIETIESICPTVARFSGLLRM 97 >DQ080905-1|AAY89551.1| 120|Anopheles gambiae olfactory receptor 38 protein. Length = 120 Score = 24.2 bits (50), Expect = 4.3 Identities = 8/24 (33%), Positives = 18/24 (75%) Frame = +2 Query: 137 NGTVTRTLRALNPDQAQYSGLIQV 208 NG++ T+ ++ P A++SGL+++ Sbjct: 74 NGSLIETIESICPTVARFSGLLRM 97 >DQ080904-1|AAY89550.1| 120|Anopheles gambiae olfactory receptor 38 protein. Length = 120 Score = 24.2 bits (50), Expect = 4.3 Identities = 8/24 (33%), Positives = 18/24 (75%) Frame = +2 Query: 137 NGTVTRTLRALNPDQAQYSGLIQV 208 NG++ T+ ++ P A++SGL+++ Sbjct: 74 NGSLIETIESICPTVARFSGLLRM 97 >DQ080903-1|AAY89549.1| 120|Anopheles gambiae olfactory receptor 38 protein. Length = 120 Score = 24.2 bits (50), Expect = 4.3 Identities = 8/24 (33%), Positives = 18/24 (75%) Frame = +2 Query: 137 NGTVTRTLRALNPDQAQYSGLIQV 208 NG++ T+ ++ P A++SGL+++ Sbjct: 74 NGSLIETIESICPTVARFSGLLRM 97 >DQ080902-1|AAY89548.1| 120|Anopheles gambiae olfactory receptor 38 protein. Length = 120 Score = 24.2 bits (50), Expect = 4.3 Identities = 8/24 (33%), Positives = 18/24 (75%) Frame = +2 Query: 137 NGTVTRTLRALNPDQAQYSGLIQV 208 NG++ T+ ++ P A++SGL+++ Sbjct: 74 NGSLIETIESICPTVARFSGLLRM 97 >DQ080901-1|AAY89547.1| 120|Anopheles gambiae olfactory receptor 38 protein. Length = 120 Score = 24.2 bits (50), Expect = 4.3 Identities = 8/24 (33%), Positives = 18/24 (75%) Frame = +2 Query: 137 NGTVTRTLRALNPDQAQYSGLIQV 208 NG++ T+ ++ P A++SGL+++ Sbjct: 74 NGSLIETIESICPTVARFSGLLRM 97 >DQ080900-1|AAY89546.1| 120|Anopheles gambiae olfactory receptor 38 protein. Length = 120 Score = 24.2 bits (50), Expect = 4.3 Identities = 8/24 (33%), Positives = 18/24 (75%) Frame = +2 Query: 137 NGTVTRTLRALNPDQAQYSGLIQV 208 NG++ T+ ++ P A++SGL+++ Sbjct: 74 NGSLIETIESICPTVARFSGLLRM 97 >DQ080899-1|AAY89545.1| 120|Anopheles gambiae olfactory receptor 38 protein. Length = 120 Score = 24.2 bits (50), Expect = 4.3 Identities = 8/24 (33%), Positives = 18/24 (75%) Frame = +2 Query: 137 NGTVTRTLRALNPDQAQYSGLIQV 208 NG++ T+ ++ P A++SGL+++ Sbjct: 74 NGSLIETIESICPTVARFSGLLRM 97 >DQ080898-1|AAY89544.1| 120|Anopheles gambiae olfactory receptor 38 protein. Length = 120 Score = 24.2 bits (50), Expect = 4.3 Identities = 8/24 (33%), Positives = 18/24 (75%) Frame = +2 Query: 137 NGTVTRTLRALNPDQAQYSGLIQV 208 NG++ T+ ++ P A++SGL+++ Sbjct: 74 NGSLIETIESICPTVARFSGLLRM 97 >DQ080897-1|AAY89543.1| 120|Anopheles gambiae olfactory receptor 38 protein. Length = 120 Score = 24.2 bits (50), Expect = 4.3 Identities = 8/24 (33%), Positives = 18/24 (75%) Frame = +2 Query: 137 NGTVTRTLRALNPDQAQYSGLIQV 208 NG++ T+ ++ P A++SGL+++ Sbjct: 74 NGSLIETIESICPTVARFSGLLRM 97 >DQ080896-1|AAY89542.1| 120|Anopheles gambiae olfactory receptor 38 protein. Length = 120 Score = 24.2 bits (50), Expect = 4.3 Identities = 8/24 (33%), Positives = 18/24 (75%) Frame = +2 Query: 137 NGTVTRTLRALNPDQAQYSGLIQV 208 NG++ T+ ++ P A++SGL+++ Sbjct: 74 NGSLIETIESICPTVARFSGLLRM 97 >DQ080895-1|AAY89541.1| 120|Anopheles gambiae olfactory receptor 38 protein. Length = 120 Score = 24.2 bits (50), Expect = 4.3 Identities = 8/24 (33%), Positives = 18/24 (75%) Frame = +2 Query: 137 NGTVTRTLRALNPDQAQYSGLIQV 208 NG++ T+ ++ P A++SGL+++ Sbjct: 74 NGSLIETIESICPTVARFSGLLRM 97 >DQ080894-1|AAY89540.1| 120|Anopheles gambiae olfactory receptor 38 protein. Length = 120 Score = 24.2 bits (50), Expect = 4.3 Identities = 8/24 (33%), Positives = 18/24 (75%) Frame = +2 Query: 137 NGTVTRTLRALNPDQAQYSGLIQV 208 NG++ T+ ++ P A++SGL+++ Sbjct: 74 NGSLIETIESICPTVARFSGLLRM 97 >DQ080893-1|AAY89539.1| 120|Anopheles gambiae olfactory receptor 38 protein. Length = 120 Score = 24.2 bits (50), Expect = 4.3 Identities = 8/24 (33%), Positives = 18/24 (75%) Frame = +2 Query: 137 NGTVTRTLRALNPDQAQYSGLIQV 208 NG++ T+ ++ P A++SGL+++ Sbjct: 74 NGSLIETIESICPTVARFSGLLRM 97 >DQ080892-1|AAY89538.1| 120|Anopheles gambiae olfactory receptor 38 protein. Length = 120 Score = 24.2 bits (50), Expect = 4.3 Identities = 8/24 (33%), Positives = 18/24 (75%) Frame = +2 Query: 137 NGTVTRTLRALNPDQAQYSGLIQV 208 NG++ T+ ++ P A++SGL+++ Sbjct: 74 NGSLIETIESICPTVARFSGLLRM 97 >DQ080891-1|AAY89537.1| 120|Anopheles gambiae olfactory receptor 38 protein. Length = 120 Score = 24.2 bits (50), Expect = 4.3 Identities = 8/24 (33%), Positives = 18/24 (75%) Frame = +2 Query: 137 NGTVTRTLRALNPDQAQYSGLIQV 208 NG++ T+ ++ P A++SGL+++ Sbjct: 74 NGSLIETIESICPTVARFSGLLRM 97 >DQ080890-1|AAY89536.1| 120|Anopheles gambiae olfactory receptor 38 protein. Length = 120 Score = 24.2 bits (50), Expect = 4.3 Identities = 8/24 (33%), Positives = 18/24 (75%) Frame = +2 Query: 137 NGTVTRTLRALNPDQAQYSGLIQV 208 NG++ T+ ++ P A++SGL+++ Sbjct: 74 NGSLIETIESICPTVARFSGLLRM 97 >DQ080889-1|AAY89535.1| 120|Anopheles gambiae olfactory receptor 38 protein. Length = 120 Score = 24.2 bits (50), Expect = 4.3 Identities = 8/24 (33%), Positives = 18/24 (75%) Frame = +2 Query: 137 NGTVTRTLRALNPDQAQYSGLIQV 208 NG++ T+ ++ P A++SGL+++ Sbjct: 74 NGSLIETIESICPTVARFSGLLRM 97 >DQ080888-1|AAY89534.1| 120|Anopheles gambiae olfactory receptor 38 protein. Length = 120 Score = 24.2 bits (50), Expect = 4.3 Identities = 8/24 (33%), Positives = 18/24 (75%) Frame = +2 Query: 137 NGTVTRTLRALNPDQAQYSGLIQV 208 NG++ T+ ++ P A++SGL+++ Sbjct: 74 NGSLIETIESICPTVARFSGLLRM 97 >DQ080887-1|AAY89533.1| 120|Anopheles gambiae olfactory receptor 38 protein. Length = 120 Score = 24.2 bits (50), Expect = 4.3 Identities = 8/24 (33%), Positives = 18/24 (75%) Frame = +2 Query: 137 NGTVTRTLRALNPDQAQYSGLIQV 208 NG++ T+ ++ P A++SGL+++ Sbjct: 74 NGSLIETIESICPTVARFSGLLRM 97 >DQ080886-1|AAY89532.1| 120|Anopheles gambiae olfactory receptor 38 protein. Length = 120 Score = 24.2 bits (50), Expect = 4.3 Identities = 8/24 (33%), Positives = 18/24 (75%) Frame = +2 Query: 137 NGTVTRTLRALNPDQAQYSGLIQV 208 NG++ T+ ++ P A++SGL+++ Sbjct: 74 NGSLIETIESICPTVARFSGLLRM 97 >DQ080885-1|AAY89531.1| 120|Anopheles gambiae olfactory receptor 38 protein. Length = 120 Score = 24.2 bits (50), Expect = 4.3 Identities = 8/24 (33%), Positives = 18/24 (75%) Frame = +2 Query: 137 NGTVTRTLRALNPDQAQYSGLIQV 208 NG++ T+ ++ P A++SGL+++ Sbjct: 74 NGSLIETIESICPTVARFSGLLRM 97 >DQ080884-1|AAY89530.1| 120|Anopheles gambiae olfactory receptor 38 protein. Length = 120 Score = 24.2 bits (50), Expect = 4.3 Identities = 8/24 (33%), Positives = 18/24 (75%) Frame = +2 Query: 137 NGTVTRTLRALNPDQAQYSGLIQV 208 NG++ T+ ++ P A++SGL+++ Sbjct: 74 NGSLIETIESICPTVARFSGLLRM 97 >DQ080883-1|AAY89529.1| 120|Anopheles gambiae olfactory receptor 38 protein. Length = 120 Score = 24.2 bits (50), Expect = 4.3 Identities = 8/24 (33%), Positives = 18/24 (75%) Frame = +2 Query: 137 NGTVTRTLRALNPDQAQYSGLIQV 208 NG++ T+ ++ P A++SGL+++ Sbjct: 74 NGSLIETIESICPTVARFSGLLRM 97 >DQ080882-1|AAY89528.1| 120|Anopheles gambiae olfactory receptor 38 protein. Length = 120 Score = 24.2 bits (50), Expect = 4.3 Identities = 8/24 (33%), Positives = 18/24 (75%) Frame = +2 Query: 137 NGTVTRTLRALNPDQAQYSGLIQV 208 NG++ T+ ++ P A++SGL+++ Sbjct: 74 NGSLIETIESICPTVARFSGLLRM 97 >DQ080881-1|AAY89527.1| 120|Anopheles gambiae olfactory receptor 38 protein. Length = 120 Score = 24.2 bits (50), Expect = 4.3 Identities = 8/24 (33%), Positives = 18/24 (75%) Frame = +2 Query: 137 NGTVTRTLRALNPDQAQYSGLIQV 208 NG++ T+ ++ P A++SGL+++ Sbjct: 74 NGSLIETIESICPTVARFSGLLRM 97 >DQ080880-1|AAY89526.1| 120|Anopheles gambiae olfactory receptor 38 protein. Length = 120 Score = 24.2 bits (50), Expect = 4.3 Identities = 8/24 (33%), Positives = 18/24 (75%) Frame = +2 Query: 137 NGTVTRTLRALNPDQAQYSGLIQV 208 NG++ T+ ++ P A++SGL+++ Sbjct: 74 NGSLIETIESICPTVARFSGLLRM 97 >DQ080879-1|AAY89525.1| 120|Anopheles gambiae olfactory receptor 38 protein. Length = 120 Score = 24.2 bits (50), Expect = 4.3 Identities = 8/24 (33%), Positives = 18/24 (75%) Frame = +2 Query: 137 NGTVTRTLRALNPDQAQYSGLIQV 208 NG++ T+ ++ P A++SGL+++ Sbjct: 74 NGSLIETIESICPTVARFSGLLRM 97 >DQ080878-1|AAY89524.1| 120|Anopheles gambiae olfactory receptor 38 protein. Length = 120 Score = 24.2 bits (50), Expect = 4.3 Identities = 8/24 (33%), Positives = 18/24 (75%) Frame = +2 Query: 137 NGTVTRTLRALNPDQAQYSGLIQV 208 NG++ T+ ++ P A++SGL+++ Sbjct: 74 NGSLIETIESICPTVARFSGLLRM 97 >DQ080877-1|AAY89523.1| 120|Anopheles gambiae olfactory receptor 38 protein. Length = 120 Score = 24.2 bits (50), Expect = 4.3 Identities = 8/24 (33%), Positives = 18/24 (75%) Frame = +2 Query: 137 NGTVTRTLRALNPDQAQYSGLIQV 208 NG++ T+ ++ P A++SGL+++ Sbjct: 74 NGSLIETIESICPTVARFSGLLRM 97 >DQ080876-1|AAY89522.1| 120|Anopheles gambiae olfactory receptor 38 protein. Length = 120 Score = 24.2 bits (50), Expect = 4.3 Identities = 8/24 (33%), Positives = 18/24 (75%) Frame = +2 Query: 137 NGTVTRTLRALNPDQAQYSGLIQV 208 NG++ T+ ++ P A++SGL+++ Sbjct: 74 NGSLIETIESICPTVARFSGLLRM 97 >DQ080875-1|AAY89521.1| 120|Anopheles gambiae olfactory receptor 38 protein. Length = 120 Score = 24.2 bits (50), Expect = 4.3 Identities = 8/24 (33%), Positives = 18/24 (75%) Frame = +2 Query: 137 NGTVTRTLRALNPDQAQYSGLIQV 208 NG++ T+ ++ P A++SGL+++ Sbjct: 74 NGSLIETIESICPTVARFSGLLRM 97 >DQ080874-1|AAY89520.1| 120|Anopheles gambiae olfactory receptor 38 protein. Length = 120 Score = 24.2 bits (50), Expect = 4.3 Identities = 8/24 (33%), Positives = 18/24 (75%) Frame = +2 Query: 137 NGTVTRTLRALNPDQAQYSGLIQV 208 NG++ T+ ++ P A++SGL+++ Sbjct: 74 NGSLIETIESICPTVARFSGLLRM 97 >DQ080873-1|AAY89519.1| 120|Anopheles gambiae olfactory receptor 38 protein. Length = 120 Score = 24.2 bits (50), Expect = 4.3 Identities = 8/24 (33%), Positives = 18/24 (75%) Frame = +2 Query: 137 NGTVTRTLRALNPDQAQYSGLIQV 208 NG++ T+ ++ P A++SGL+++ Sbjct: 74 NGSLIETIESICPTVARFSGLLRM 97 >DQ080872-1|AAY89518.1| 120|Anopheles gambiae olfactory receptor 38 protein. Length = 120 Score = 24.2 bits (50), Expect = 4.3 Identities = 8/24 (33%), Positives = 18/24 (75%) Frame = +2 Query: 137 NGTVTRTLRALNPDQAQYSGLIQV 208 NG++ T+ ++ P A++SGL+++ Sbjct: 74 NGSLIETIESICPTVARFSGLLRM 97 >DQ080871-1|AAY89517.1| 120|Anopheles gambiae olfactory receptor 38 protein. Length = 120 Score = 24.2 bits (50), Expect = 4.3 Identities = 8/24 (33%), Positives = 18/24 (75%) Frame = +2 Query: 137 NGTVTRTLRALNPDQAQYSGLIQV 208 NG++ T+ ++ P A++SGL+++ Sbjct: 74 NGSLIETIESICPTVARFSGLLRM 97 >DQ080870-1|AAY89516.1| 120|Anopheles gambiae olfactory receptor 38 protein. Length = 120 Score = 24.2 bits (50), Expect = 4.3 Identities = 8/24 (33%), Positives = 18/24 (75%) Frame = +2 Query: 137 NGTVTRTLRALNPDQAQYSGLIQV 208 NG++ T+ ++ P A++SGL+++ Sbjct: 74 NGSLIETIESICPTVARFSGLLRM 97 >DQ080869-1|AAY89515.1| 120|Anopheles gambiae olfactory receptor 38 protein. Length = 120 Score = 24.2 bits (50), Expect = 4.3 Identities = 8/24 (33%), Positives = 18/24 (75%) Frame = +2 Query: 137 NGTVTRTLRALNPDQAQYSGLIQV 208 NG++ T+ ++ P A++SGL+++ Sbjct: 74 NGSLIETIESICPTVARFSGLLRM 97 >DQ080868-1|AAY89514.1| 120|Anopheles gambiae olfactory receptor 38 protein. Length = 120 Score = 24.2 bits (50), Expect = 4.3 Identities = 8/24 (33%), Positives = 18/24 (75%) Frame = +2 Query: 137 NGTVTRTLRALNPDQAQYSGLIQV 208 NG++ T+ ++ P A++SGL+++ Sbjct: 74 NGSLIETIESICPTVARFSGLLRM 97 >DQ080867-1|AAY89513.1| 120|Anopheles gambiae olfactory receptor 38 protein. Length = 120 Score = 24.2 bits (50), Expect = 4.3 Identities = 8/24 (33%), Positives = 18/24 (75%) Frame = +2 Query: 137 NGTVTRTLRALNPDQAQYSGLIQV 208 NG++ T+ ++ P A++SGL+++ Sbjct: 74 NGSLIETIESICPTVARFSGLLRM 97 >DQ080866-1|AAY89512.1| 120|Anopheles gambiae olfactory receptor 38 protein. Length = 120 Score = 24.2 bits (50), Expect = 4.3 Identities = 8/24 (33%), Positives = 18/24 (75%) Frame = +2 Query: 137 NGTVTRTLRALNPDQAQYSGLIQV 208 NG++ T+ ++ P A++SGL+++ Sbjct: 74 NGSLIETIESICPTVARFSGLLRM 97 >DQ080865-1|AAY89511.1| 120|Anopheles gambiae olfactory receptor 38 protein. Length = 120 Score = 24.2 bits (50), Expect = 4.3 Identities = 8/24 (33%), Positives = 18/24 (75%) Frame = +2 Query: 137 NGTVTRTLRALNPDQAQYSGLIQV 208 NG++ T+ ++ P A++SGL+++ Sbjct: 74 NGSLIETIESICPTVARFSGLLRM 97 >DQ080864-1|AAY89510.1| 120|Anopheles gambiae olfactory receptor 38 protein. Length = 120 Score = 24.2 bits (50), Expect = 4.3 Identities = 8/24 (33%), Positives = 18/24 (75%) Frame = +2 Query: 137 NGTVTRTLRALNPDQAQYSGLIQV 208 NG++ T+ ++ P A++SGL+++ Sbjct: 74 NGSLIETIESICPTVARFSGLLRM 97 >DQ080863-1|AAY89509.1| 120|Anopheles gambiae olfactory receptor 38 protein. Length = 120 Score = 24.2 bits (50), Expect = 4.3 Identities = 8/24 (33%), Positives = 18/24 (75%) Frame = +2 Query: 137 NGTVTRTLRALNPDQAQYSGLIQV 208 NG++ T+ ++ P A++SGL+++ Sbjct: 74 NGSLIETIESICPTVARFSGLLRM 97 >DQ080862-1|AAY89508.1| 120|Anopheles gambiae olfactory receptor 38 protein. Length = 120 Score = 24.2 bits (50), Expect = 4.3 Identities = 8/24 (33%), Positives = 18/24 (75%) Frame = +2 Query: 137 NGTVTRTLRALNPDQAQYSGLIQV 208 NG++ T+ ++ P A++SGL+++ Sbjct: 74 NGSLIETIESICPTVARFSGLLRM 97 >AJ438610-4|CAD27476.1| 593|Anopheles gambiae putative transcription factor protein. Length = 593 Score = 24.2 bits (50), Expect = 4.3 Identities = 8/14 (57%), Positives = 11/14 (78%) Frame = -2 Query: 63 QPPPEPFRRPKLYS 22 QPPP P++ P+ YS Sbjct: 375 QPPPPPYQPPQPYS 388 >AY545988-1|AAS99341.1| 423|Anopheles gambiae carboxypeptidase B precursor protein. Length = 423 Score = 23.8 bits (49), Expect = 5.7 Identities = 10/31 (32%), Positives = 16/31 (51%) Frame = +3 Query: 189 IPV*FKWKVGQAMSLALWDYHASVRFCRLVI 281 + V KW+ GQ + + WD R RL++ Sbjct: 38 LSVLLKWRNGQEIEVDFWDAPKVGRSARLMV 68 >AY070257-1|AAL59656.1| 217|Anopheles gambiae glutathione S-transferase e8 protein. Length = 217 Score = 23.8 bits (49), Expect = 5.7 Identities = 12/43 (27%), Positives = 24/43 (55%) Frame = +2 Query: 8 LGIEVEYSLGRLNGSGGGCASAEYVRVLARGTIPIAKPLEPTL 136 LG++ L ++ GG S++Y+++ T+P+ + E TL Sbjct: 22 LGVKDRIKLEYIDLFKGGHLSSDYLKINPLHTVPVLRHGELTL 64 >AJ627286-1|CAF28572.1| 423|Anopheles gambiae carboxypeptidase B protein. Length = 423 Score = 23.8 bits (49), Expect = 5.7 Identities = 10/31 (32%), Positives = 16/31 (51%) Frame = +3 Query: 189 IPV*FKWKVGQAMSLALWDYHASVRFCRLVI 281 + V KW+ GQ + + WD R RL++ Sbjct: 38 LSVLLKWRNGQEIEVDFWDAPKVGRSARLMV 68 >AJ441131-7|CAD29636.1| 1977|Anopheles gambiae putative Tyr/Ser/Thr phosphatase protein. Length = 1977 Score = 23.8 bits (49), Expect = 5.7 Identities = 11/41 (26%), Positives = 19/41 (46%) Frame = -3 Query: 692 DDADGSLSIRRGRVECAQQSLEALPTPPTKPSGAEREAALD 570 D A R + +C++ S + +PP P G+ E +D Sbjct: 276 DKAGDGTRRTRTQTDCSEASSDG--SPPRSPEGSHEEVEMD 314 >AJ439398-6|CAD28129.1| 1978|Anopheles gambiae putative Tyr/Ser/Thr phosphatase protein. Length = 1978 Score = 23.8 bits (49), Expect = 5.7 Identities = 11/41 (26%), Positives = 19/41 (46%) Frame = -3 Query: 692 DDADGSLSIRRGRVECAQQSLEALPTPPTKPSGAEREAALD 570 D A R + +C++ S + +PP P G+ E +D Sbjct: 276 DKAGDGTRRTRTQTDCSEASSDG--SPPRSPEGSHEEVEMD 314 >AY056833-1|AAL23627.1| 1253|Anopheles gambiae chitin synthase protein. Length = 1253 Score = 23.4 bits (48), Expect = 7.5 Identities = 8/24 (33%), Positives = 17/24 (70%) Frame = -1 Query: 328 HYVTGPSLYVSLKSYWITNLQNLT 257 +Y+T PS+Y+ L Y + N+ +++ Sbjct: 694 YYITIPSMYMLLVIYSVFNMNDVS 717 >AY553322-1|AAT36323.1| 426|Anopheles gambiae G-protein coupled receptor 4 protein. Length = 426 Score = 23.0 bits (47), Expect = 9.9 Identities = 15/32 (46%), Positives = 18/32 (56%), Gaps = 3/32 (9%) Frame = +3 Query: 369 KVFL---AFCLSTAKILVVCSSTCLRFEVIPP 455 KVFL AFCL + ++VC S F VI P Sbjct: 151 KVFLFMRAFCLYLSSNVLVCVSLDRCFAVIYP 182 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 811,164 Number of Sequences: 2352 Number of extensions: 16908 Number of successful extensions: 89 Number of sequences better than 10.0: 59 Number of HSP's better than 10.0 without gapping: 85 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 89 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 76091949 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -