BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0823 (742 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AC006797-1|AAF60743.1| 1079|Caenorhabditis elegans Hypothetical ... 28 6.0 Z81465-2|CAB03861.1| 1642|Caenorhabditis elegans Hypothetical pr... 28 8.0 >AC006797-1|AAF60743.1| 1079|Caenorhabditis elegans Hypothetical protein Y51B11A.1 protein. Length = 1079 Score = 28.3 bits (60), Expect = 6.0 Identities = 16/48 (33%), Positives = 24/48 (50%), Gaps = 5/48 (10%) Frame = -2 Query: 495 VSITNSTVSPDCNSEGLPR-----TSDMWKNKRRVSSPSTDKKPKTPF 367 V T +TV DC+ + R T++ W+NKR + S D +T F Sbjct: 947 VQTTTTTVPCDCSLSYIDRVVYPFTTEWWENKRDIIIQSYDSPRRTAF 994 >Z81465-2|CAB03861.1| 1642|Caenorhabditis elegans Hypothetical protein C09F9.2 protein. Length = 1642 Score = 27.9 bits (59), Expect = 8.0 Identities = 17/62 (27%), Positives = 26/62 (41%), Gaps = 3/62 (4%) Frame = -1 Query: 730 DQDVSLGQQFCDGTTRTEASRSVGAAWSAHSNHSRP-CRLLQRSRPEPR--EKPLWTFTS 560 D+DV + FCD T E + + W+ P C + + P P EKP T Sbjct: 373 DEDVCVPFDFCDKTVENEETCEANSTWAKCGTACEPTCANMYDTAPCPASCEKPGCTCAD 432 Query: 559 HF 554 ++ Sbjct: 433 NY 434 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,802,334 Number of Sequences: 27780 Number of extensions: 385107 Number of successful extensions: 1408 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1296 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1408 length of database: 12,740,198 effective HSP length: 80 effective length of database: 10,517,798 effective search space used: 1745954468 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -