BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0822 (830 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z81465-2|CAB03861.1| 1642|Caenorhabditis elegans Hypothetical pr... 28 7.1 AC006797-1|AAF60743.1| 1079|Caenorhabditis elegans Hypothetical ... 28 7.1 >Z81465-2|CAB03861.1| 1642|Caenorhabditis elegans Hypothetical protein C09F9.2 protein. Length = 1642 Score = 28.3 bits (60), Expect = 7.1 Identities = 24/84 (28%), Positives = 34/84 (40%), Gaps = 9/84 (10%) Frame = -2 Query: 778 NYVHSCKMFRSCC--GLV----DQDVSLGQQFCDGTTRTEASRSVGAAWSAHSNHSRP-C 620 N +SC R C G V D+DV + FCD T E + + W+ P C Sbjct: 351 NCPNSCGTPRCICKEGFVRMANDEDVCVPFDFCDKTVENEETCEANSTWAKCGTACEPTC 410 Query: 619 RLLQRSRPEPR--EKPLWTFTSHF 554 + + P P EKP T ++ Sbjct: 411 ANMYDTAPCPASCEKPGCTCADNY 434 >AC006797-1|AAF60743.1| 1079|Caenorhabditis elegans Hypothetical protein Y51B11A.1 protein. Length = 1079 Score = 28.3 bits (60), Expect = 7.1 Identities = 16/48 (33%), Positives = 24/48 (50%), Gaps = 5/48 (10%) Frame = -3 Query: 495 VSITNSTVSPDCNSEGLPR-----TSDMWKNKRRVSSPSTDKKPKTPF 367 V T +TV DC+ + R T++ W+NKR + S D +T F Sbjct: 947 VQTTTTTVPCDCSLSYIDRVVYPFTTEWWENKRDIIIQSYDSPRRTAF 994 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,665,844 Number of Sequences: 27780 Number of extensions: 428833 Number of successful extensions: 1542 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1400 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1542 length of database: 12,740,198 effective HSP length: 80 effective length of database: 10,517,798 effective search space used: 2061488408 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -