BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0821 (751 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_41601| Best HMM Match : zf-C2H2 (HMM E-Value=0.0019) 28 9.3 SB_36082| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 >SB_41601| Best HMM Match : zf-C2H2 (HMM E-Value=0.0019) Length = 1008 Score = 27.9 bits (59), Expect = 9.3 Identities = 18/63 (28%), Positives = 23/63 (36%) Frame = +2 Query: 224 MLQLSGPLSSVPSRMHRPCKXXXXXXXXXXXXRGPASPKLPLGPDKLKRSRMPELWMQLA 403 ML PL +R RP +GP P + G D +R P+ W Q Sbjct: 265 MLPPGAPLRPYQARPLRPDMAQTWATPMGQSTQGPNVPGIRPGMDGAQRGTTPQGWQQAP 324 Query: 404 SLT 412 S T Sbjct: 325 STT 327 >SB_36082| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 366 Score = 27.9 bits (59), Expect = 9.3 Identities = 13/28 (46%), Positives = 14/28 (50%), Gaps = 2/28 (7%) Frame = +3 Query: 69 CRTIRLYRTFTG--RSWKLRSGRSVHWR 146 C R TF G R WK +G SV WR Sbjct: 251 CHLKRRQETFNGDTRHWKRATGESVQWR 278 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,191,937 Number of Sequences: 59808 Number of extensions: 238420 Number of successful extensions: 881 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 817 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 881 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 2034222073 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -