BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0821 (751 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g22780.1 68416.m02872 CXC domain protein (TSO1) identical to ... 29 2.5 At2g33845.1 68415.m04154 DNA-binding protein-related contains we... 29 4.4 At1g76500.1 68414.m08901 DNA-binding family protein contains Pfa... 28 5.8 At1g03910.1 68414.m00376 expressed protein low similarity to cac... 28 7.6 >At3g22780.1 68416.m02872 CXC domain protein (TSO1) identical to CXC domain protein TSO1 [Arabidopsis thaliana] GI:7767425 Length = 695 Score = 29.5 bits (63), Expect = 2.5 Identities = 12/30 (40%), Positives = 19/30 (63%) Frame = -1 Query: 736 PASSDQSSPHPPKQHLPKHRRF*RRHQLQP 647 P+S S+P PP +HL H+ F +++L P Sbjct: 566 PSSDQPSTPLPPYRHLVVHQPFLSKNRLPP 595 >At2g33845.1 68415.m04154 DNA-binding protein-related contains weak similarity to G-quartet DNA binding protein 3 [Tetrahymena thermophila] gi|4583503|gb|AAD25098 Length = 182 Score = 28.7 bits (61), Expect = 4.4 Identities = 14/38 (36%), Positives = 23/38 (60%), Gaps = 3/38 (7%) Frame = -1 Query: 736 PASSDQSSPHPPKQHLPKHRR---F*RRHQLQPGPELH 632 P+SS ++S + P QH P+ ++ F + QL+PG H Sbjct: 33 PSSSTRTSQNQPPQHTPQEKKKPVFVKVDQLKPGTSGH 70 >At1g76500.1 68414.m08901 DNA-binding family protein contains Pfam domain, PF02178: AT hook motif Length = 302 Score = 28.3 bits (60), Expect = 5.8 Identities = 11/18 (61%), Positives = 14/18 (77%) Frame = -1 Query: 661 HQLQPGPELH**PRRQPE 608 HQLQP P+LH P+ QP+ Sbjct: 25 HQLQPQPQLHPLPQPQPQ 42 >At1g03910.1 68414.m00376 expressed protein low similarity to cactin [Drosophila melanogaster] GI:7673675; expression supported by MPSS Length = 672 Score = 27.9 bits (59), Expect = 7.6 Identities = 18/46 (39%), Positives = 26/46 (56%), Gaps = 1/46 (2%) Frame = -2 Query: 261 DGTE-LSGPDSCSIVQCCSTAESRSGSNYSRSCDSNGGRPANVRSS 127 DG++ LS P S + S+ +R S+ S DS+GGR + RSS Sbjct: 36 DGSDDLSPPRSSRRKKGSSSRRTRRRSSSDDSSDSDGGRKSKKRSS 81 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,830,095 Number of Sequences: 28952 Number of extensions: 159262 Number of successful extensions: 473 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 451 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 473 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1663169840 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -