BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0819 (844 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AF469010-1|AAL93136.1| 678|Apis mellifera cGMP-dependent protei... 26 0.38 DQ257416-1|ABB81847.1| 552|Apis mellifera yellow-h protein. 24 2.0 AY769960-1|AAV34676.1| 603|Apis mellifera soluble guanylyl cycl... 23 2.7 AB181489-1|BAD22772.1| 603|Apis mellifera soluble guanylyl cycl... 23 2.7 EF625898-1|ABR45905.1| 686|Apis mellifera hexamerin protein. 23 3.5 DQ435333-1|ABD92648.1| 135|Apis mellifera OBP16 protein. 23 3.5 DQ435327-1|ABD92642.1| 145|Apis mellifera OBP10 protein. 22 6.2 >AF469010-1|AAL93136.1| 678|Apis mellifera cGMP-dependent protein kinase foraging protein. Length = 678 Score = 26.2 bits (55), Expect = 0.38 Identities = 17/55 (30%), Positives = 32/55 (58%), Gaps = 1/55 (1%) Frame = +2 Query: 506 DQSSARAKTFLSTAQVVDD-QVFAIVSDEKVIKELEAEDEDVVLFKNFEEKRVKY 667 D S + A + AQ+V+ Q I+S+++++ E + D V LFK F++++ Y Sbjct: 389 DSSRSFALKQMKKAQIVETRQQQHIMSEKRIMGEADC-DFVVKLFKTFKDRKYLY 442 >DQ257416-1|ABB81847.1| 552|Apis mellifera yellow-h protein. Length = 552 Score = 23.8 bits (49), Expect = 2.0 Identities = 14/51 (27%), Positives = 23/51 (45%) Frame = -1 Query: 430 SRGASLLLQPTDDVISLTTT*IVDRTAIPEEFESRVSSYTVALGEILFLSC 278 ++G L P + LTT ++ + IP+E S YT + +I C Sbjct: 270 AKGGKLACPPAIFIFDLTTDTLIRKYIIPKEQVKEDSLYTNIVVDIRNEDC 320 >AY769960-1|AAV34676.1| 603|Apis mellifera soluble guanylyl cyclase beta 1 subunit protein. Length = 603 Score = 23.4 bits (48), Expect = 2.7 Identities = 10/28 (35%), Positives = 16/28 (57%) Frame = -3 Query: 209 VPEICSGRTMEHRIQLKCTPWL*LQFQS 126 +P++CSG + I L P L L F++ Sbjct: 238 IPQVCSGNCKLNDILLTVRPHLELTFEN 265 >AB181489-1|BAD22772.1| 603|Apis mellifera soluble guanylyl cyclase beta 1 subunit protein. Length = 603 Score = 23.4 bits (48), Expect = 2.7 Identities = 10/28 (35%), Positives = 16/28 (57%) Frame = -3 Query: 209 VPEICSGRTMEHRIQLKCTPWL*LQFQS 126 +P++CSG + I L P L L F++ Sbjct: 238 IPQVCSGNCKLNDILLTVRPHLELTFEN 265 >EF625898-1|ABR45905.1| 686|Apis mellifera hexamerin protein. Length = 686 Score = 23.0 bits (47), Expect = 3.5 Identities = 8/15 (53%), Positives = 11/15 (73%) Frame = -1 Query: 757 SSFMREFNDSRHALD 713 S +MRE+ND + LD Sbjct: 208 SKYMREYNDPEYKLD 222 >DQ435333-1|ABD92648.1| 135|Apis mellifera OBP16 protein. Length = 135 Score = 23.0 bits (47), Expect = 3.5 Identities = 22/87 (25%), Positives = 37/87 (42%) Frame = +2 Query: 527 KTFLSTAQVVDDQVFAIVSDEKVIKELEAEDEDVVLFKNFEEKRVKYEDEEITEDLLNAW 706 + + V D+ V + V E ++K+ DE+ NF EK + + + +D Sbjct: 46 EVYNGNVNVEDENVQSYV--ECMMKKFNVVDEN----GNFNEKNTRDIVQAVLDDNETDQ 99 Query: 707 VFVQSMPTIVEFSHETASKIFGGKIKY 787 + V+ P H SKIF +KY Sbjct: 100 LIVECSPISDANVHIKISKIFQCFMKY 126 >DQ435327-1|ABD92642.1| 145|Apis mellifera OBP10 protein. Length = 145 Score = 22.2 bits (45), Expect = 6.2 Identities = 8/16 (50%), Positives = 10/16 (62%) Frame = +1 Query: 460 RTYRCQYCYCIWFLFG 507 R +C Y YC+W FG Sbjct: 67 RQLKC-YMYCLWEQFG 81 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 217,582 Number of Sequences: 438 Number of extensions: 4003 Number of successful extensions: 11 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 11 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 27067071 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -