BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0818 (529 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC823.16c |mug179||WD repeat protein Mug179|Schizosaccharomyce... 26 4.0 SPCC737.07c |||DNA polymerase alpha-associated DNA helicase A |S... 25 5.3 SPCC645.04 |nse3||Smc5-6 complex non-SMC subunit Nse3 |Schizosac... 25 5.3 SPBC6B1.07 |prp1|zer1|U4/U6 x U5 tri-snRNP complex subunit Prp1|... 25 7.0 SPBC8D2.12c |||mitochondrial DNA binding protein |Schizosaccharo... 25 7.0 SPCC364.04c |||CASP family protein|Schizosaccharomyces pombe|chr... 25 9.2 SPAC3A11.14c |pkl1|klp1, SPAC3H5.03c|kinesin-like protein Pkl1|S... 25 9.2 >SPAC823.16c |mug179||WD repeat protein Mug179|Schizosaccharomyces pombe|chr 1|||Manual Length = 335 Score = 25.8 bits (54), Expect = 4.0 Identities = 14/53 (26%), Positives = 23/53 (43%) Frame = -3 Query: 170 VYDLRSLSLLKTSEASKLSSIGSYLS*ASTAKNRPRKTNSSFILKFSTRFPST 12 VY+L+++ L+ T SK + I + A N P ++ T P T Sbjct: 109 VYNLKNMELINTLNTSKGNVIAFAVHENYVAYNSPTNPGDIYLASLDTAIPVT 161 >SPCC737.07c |||DNA polymerase alpha-associated DNA helicase A |Schizosaccharomyces pombe|chr 3|||Manual Length = 660 Score = 25.4 bits (53), Expect = 5.3 Identities = 24/81 (29%), Positives = 38/81 (46%), Gaps = 5/81 (6%) Frame = +1 Query: 148 ERLLKSY---TKCLLNQGPCTAELKKIKDKIPEAL--ETHCAKCTDKQKQMAKQLAQGIK 312 ERL+KS KC LN + ++ K P ++ + +K++ L + ++ Sbjct: 433 ERLVKSQGDLVKCFLN---IQYRMHELISKFPSDTFYDSKLVPAEEVKKRLLMDL-ENVE 488 Query: 313 KTHPELWDEFITFYDPQGKYQ 375 +T EL D I FYD G YQ Sbjct: 489 ET--ELTDSPIYFYDTLGNYQ 507 >SPCC645.04 |nse3||Smc5-6 complex non-SMC subunit Nse3 |Schizosaccharomyces pombe|chr 3|||Manual Length = 328 Score = 25.4 bits (53), Expect = 5.3 Identities = 15/48 (31%), Positives = 25/48 (52%) Frame = +2 Query: 224 IKFQKLWRPIVRNVLINRSRWRNNLRKELRRHTRSYGTSSLLFTTLKE 367 I FQ L R +VR + +++ RK++ + GTS LF ++ E Sbjct: 88 INFQLLVRNVVRYAICSQTSHNTITRKDIVQKAFPEGTSRNLFQSVFE 135 >SPBC6B1.07 |prp1|zer1|U4/U6 x U5 tri-snRNP complex subunit Prp1|Schizosaccharomyces pombe|chr 2|||Manual Length = 906 Score = 25.0 bits (52), Expect = 7.0 Identities = 12/41 (29%), Positives = 25/41 (60%), Gaps = 1/41 (2%) Frame = +1 Query: 223 DKIPEALETHCAKCTDKQKQMAKQL-AQGIKKTHPELWDEF 342 DKI +++E H +K Q++ +QL + +K +P++ +F Sbjct: 90 DKIYQSVEEHLSKRRKSQREKQEQLQKEKYEKENPKVSSQF 130 >SPBC8D2.12c |||mitochondrial DNA binding protein |Schizosaccharomyces pombe|chr 2|||Manual Length = 293 Score = 25.0 bits (52), Expect = 7.0 Identities = 13/35 (37%), Positives = 19/35 (54%) Frame = +2 Query: 251 IVRNVLINRSRWRNNLRKELRRHTRSYGTSSLLFT 355 IV V NR+R ++++ LR H S T LF+ Sbjct: 128 IVEAVTDNRARAASSIKHILRNHGASLSTVKFLFS 162 >SPCC364.04c |||CASP family protein|Schizosaccharomyces pombe|chr 3|||Manual Length = 633 Score = 24.6 bits (51), Expect = 9.2 Identities = 13/48 (27%), Positives = 27/48 (56%) Frame = +1 Query: 199 TAELKKIKDKIPEALETHCAKCTDKQKQMAKQLAQGIKKTHPELWDEF 342 + EL+ IK+ + +ETHCA + ++ + A+ +K+ L ++F Sbjct: 295 STELESIKEASRKEMETHCATIQTLENEVKE--ARKVKEESLTLANKF 340 >SPAC3A11.14c |pkl1|klp1, SPAC3H5.03c|kinesin-like protein Pkl1|Schizosaccharomyces pombe|chr 1|||Manual Length = 832 Score = 24.6 bits (51), Expect = 9.2 Identities = 10/23 (43%), Positives = 16/23 (69%) Frame = +1 Query: 178 LLNQGPCTAELKKIKDKIPEALE 246 +L QG CT ++ + K+KI + LE Sbjct: 307 VLIQGSCTEKILRFKEKILDLLE 329 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,024,800 Number of Sequences: 5004 Number of extensions: 39621 Number of successful extensions: 118 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 117 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 118 length of database: 2,362,478 effective HSP length: 68 effective length of database: 2,022,206 effective search space used: 216376042 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -