BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0815 (602 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ667184-1|ABG75736.1| 489|Apis mellifera GABA-gated ion channe... 26 0.25 AB161181-1|BAD08343.1| 933|Apis mellifera metabotropic glutamat... 26 0.25 AY463910-1|AAR24352.1| 843|Apis mellifera metabotropic glutamat... 25 0.43 L10710-1|AAA27730.1| 382|Apis mellifera hyaluronidase protein. 23 2.3 EF625899-1|ABR45906.1| 1010|Apis mellifera high Glx storage prot... 23 2.3 DQ468657-1|ABE02558.1| 322|Apis mellifera 1,4,5-trisphosphate r... 22 5.3 DQ288392-1|ABC41342.1| 120|Apis mellifera nanos protein. 22 5.3 >DQ667184-1|ABG75736.1| 489|Apis mellifera GABA-gated ion channel protein. Length = 489 Score = 26.2 bits (55), Expect = 0.25 Identities = 12/35 (34%), Positives = 20/35 (57%) Frame = +1 Query: 226 DADMSNLDDDRQAPPPMLNDLAFLMTGGRYRNTGR 330 +AD+ L D R +P P + + + L++G TGR Sbjct: 366 EADIIELQDLRMSPLPSIRNRSGLVSGSSTPGTGR 400 Score = 21.4 bits (43), Expect = 7.0 Identities = 6/30 (20%), Positives = 18/30 (60%) Frame = +2 Query: 38 FIGAVVLINLTWLTQW*NEDQHYGFSATGV 127 ++ +++++ L+W++ W N + A G+ Sbjct: 249 YLPSILIVMLSWVSFWINHEATSARVALGI 278 >AB161181-1|BAD08343.1| 933|Apis mellifera metabotropic glutamate receptor protein. Length = 933 Score = 26.2 bits (55), Expect = 0.25 Identities = 11/28 (39%), Positives = 16/28 (57%) Frame = +1 Query: 100 TLRFFCHRCDIEFEDVLQDYTCPYCASG 183 T + C +C+ E+E V +YTC C G Sbjct: 555 TCCWVCDQCE-EYEYVYDEYTCMDCGPG 581 >AY463910-1|AAR24352.1| 843|Apis mellifera metabotropic glutamate receptor 1 protein. Length = 843 Score = 25.4 bits (53), Expect = 0.43 Identities = 11/28 (39%), Positives = 16/28 (57%) Frame = +1 Query: 100 TLRFFCHRCDIEFEDVLQDYTCPYCASG 183 T + C +C+ E+E V +YTC C G Sbjct: 465 TCCWVCDQCE-EYEYVHDEYTCMDCGPG 491 >L10710-1|AAA27730.1| 382|Apis mellifera hyaluronidase protein. Length = 382 Score = 23.0 bits (47), Expect = 2.3 Identities = 7/17 (41%), Positives = 11/17 (64%) Frame = +1 Query: 109 FFCHRCDIEFEDVLQDY 159 F CH+ + FE+V + Y Sbjct: 52 FMCHKYGLRFEEVSEKY 68 >EF625899-1|ABR45906.1| 1010|Apis mellifera high Glx storage protein protein. Length = 1010 Score = 23.0 bits (47), Expect = 2.3 Identities = 8/17 (47%), Positives = 10/17 (58%) Frame = -2 Query: 253 HRPSCSYLHRQNHHPLH 203 H Y H+Q+HH LH Sbjct: 798 HAAQMIYGHQQSHHGLH 814 >DQ468657-1|ABE02558.1| 322|Apis mellifera 1,4,5-trisphosphate receptor protein. Length = 322 Score = 21.8 bits (44), Expect = 5.3 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = -2 Query: 166 GMYNPAKHLQILYHTCGRKTVVL 98 G P KH Q L G TVVL Sbjct: 279 GQIKPRKHEQRLLRNVGVHTVVL 301 >DQ288392-1|ABC41342.1| 120|Apis mellifera nanos protein. Length = 120 Score = 21.8 bits (44), Expect = 5.3 Identities = 7/12 (58%), Positives = 9/12 (75%) Frame = +1 Query: 145 VLQDYTCPYCAS 180 VL+ YTCP C + Sbjct: 69 VLRAYTCPICGA 80 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 158,626 Number of Sequences: 438 Number of extensions: 3169 Number of successful extensions: 9 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 17726685 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -