BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0814 (808 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY753540-1|AAV28543.1| 3320|Anopheles gambiae SGS3 protein. 27 0.90 AY753539-1|AAV28542.1| 3318|Anopheles gambiae SGS2 protein. 26 1.6 AY280611-1|AAQ21364.1| 1102|Anopheles gambiae chloride/bicarbona... 25 2.7 EF426176-1|ABO26419.1| 155|Anopheles gambiae unknown protein. 24 6.3 >AY753540-1|AAV28543.1| 3320|Anopheles gambiae SGS3 protein. Length = 3320 Score = 26.6 bits (56), Expect = 0.90 Identities = 10/20 (50%), Positives = 14/20 (70%) Frame = -1 Query: 271 RRRSPYLKHKKKHTKIEYSI 212 R+ +PYLKH K+ TK + I Sbjct: 3054 RKVNPYLKHHKRQTKTPFHI 3073 >AY753539-1|AAV28542.1| 3318|Anopheles gambiae SGS2 protein. Length = 3318 Score = 25.8 bits (54), Expect = 1.6 Identities = 10/20 (50%), Positives = 14/20 (70%) Frame = -1 Query: 271 RRRSPYLKHKKKHTKIEYSI 212 R+ +PYLKH K+ TK + I Sbjct: 3057 RKVNPYLKHHKRPTKTPFHI 3076 >AY280611-1|AAQ21364.1| 1102|Anopheles gambiae chloride/bicarbonate anion exchanger protein. Length = 1102 Score = 25.0 bits (52), Expect = 2.7 Identities = 11/31 (35%), Positives = 18/31 (58%) Frame = -3 Query: 344 SVIIKRYCNRLFKIAICQSYRYQLEATVAVF 252 SVI+K + N LF A+ + + T+A+F Sbjct: 739 SVILKDFKNALFFPAVVRQFISDFSVTIAIF 769 >EF426176-1|ABO26419.1| 155|Anopheles gambiae unknown protein. Length = 155 Score = 23.8 bits (49), Expect = 6.3 Identities = 8/17 (47%), Positives = 12/17 (70%) Frame = +1 Query: 592 CLTELCNGKRG*RSISI 642 C TELCNG G ++++ Sbjct: 125 CTTELCNGASGITAVTL 141 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 807,493 Number of Sequences: 2352 Number of extensions: 15709 Number of successful extensions: 41 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 38 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 41 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 85239615 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -