BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0814 (808 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF016677-6|AAB66145.3| 340|Caenorhabditis elegans Hypothetical ... 31 1.3 Z69384-3|CAA93418.1| 475|Caenorhabditis elegans Hypothetical pr... 28 6.8 >AF016677-6|AAB66145.3| 340|Caenorhabditis elegans Hypothetical protein ZK1240.2 protein. Length = 340 Score = 30.7 bits (66), Expect = 1.3 Identities = 14/28 (50%), Positives = 15/28 (53%) Frame = +3 Query: 135 KSEE*GHFDAEPKVKEHIYRLNSFYCIE 218 K+EE DA PK H Y L F CIE Sbjct: 78 KTEEKDSIDAPPKCASHQYNLAEFVCIE 105 >Z69384-3|CAA93418.1| 475|Caenorhabditis elegans Hypothetical protein T11G6.3 protein. Length = 475 Score = 28.3 bits (60), Expect = 6.8 Identities = 16/49 (32%), Positives = 27/49 (55%), Gaps = 2/49 (4%) Frame = +3 Query: 156 FDAEPKVKEHIYRLNSFYCIEYSI--FVCFFLCFKYGDRRLQLITIALT 296 FD+E E + L++ + I YSI ++C L Y RR+ + +AL+ Sbjct: 68 FDSEQSATEFLGALDTGFMITYSIGLYICGTLGDHYNPRRILALGMALS 116 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,958,525 Number of Sequences: 27780 Number of extensions: 375810 Number of successful extensions: 792 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 764 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 792 length of database: 12,740,198 effective HSP length: 80 effective length of database: 10,517,798 effective search space used: 1977346024 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -