BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0808 (708 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 03_05_0816 + 27928812-27930059,27931007-27931111,27931197-279312... 30 2.1 >03_05_0816 + 27928812-27930059,27931007-27931111,27931197-27931262, 27931337-27931501,27931671-27931745,27931829-27931983, 27932234-27932369,27932454-27932523,27932602-27932729, 27932838-27932894,27933326-27933511,27934031-27934123, 27934488-27934573,27934668-27934734,27934873-27934939, 27935016-27935152,27935618-27935709,27935849-27935915, 27936058-27936078 Length = 1006 Score = 29.9 bits (64), Expect = 2.1 Identities = 16/48 (33%), Positives = 24/48 (50%), Gaps = 2/48 (4%) Frame = +1 Query: 565 SRYY*ITLHDRPCQLLNALVIDNVVPGVGRV-W*HRSTVGISR-IPGW 702 SR Y + H L NA+ DN V +G++ HR + S+ +P W Sbjct: 905 SRLYNVIKHPNALDLDNAMAYDNAVSALGKICQFHRDGIDASQVVPAW 952 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,417,517 Number of Sequences: 37544 Number of extensions: 188669 Number of successful extensions: 595 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 578 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 595 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1827423340 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -