BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0805 (681 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC29A10.05 |exo1|mut2|exonuclease I Exo1|Schizosaccharomyces p... 28 1.4 SPAC19B12.01 ||SPAC4F10.21|TPR repeat protein, TTC27 family|Schi... 25 7.7 SPBC19C7.11 |||ClC chloride channel |Schizosaccharomyces pombe|c... 25 7.7 >SPBC29A10.05 |exo1|mut2|exonuclease I Exo1|Schizosaccharomyces pombe|chr 2|||Manual Length = 571 Score = 27.9 bits (59), Expect = 1.4 Identities = 16/42 (38%), Positives = 25/42 (59%) Frame = +2 Query: 539 VVLRTCQIKSI*VVYYQRWQSVHLDKKNVIDMSIQIDFNIIV 664 + LR I+SI Y Q V+L+K+N+ID I D +++V Sbjct: 135 IALREHGIESIVAPYEADAQLVYLEKENIIDGIITEDSDMLV 176 >SPAC19B12.01 ||SPAC4F10.21|TPR repeat protein, TTC27 family|Schizosaccharomyces pombe|chr 1|||Manual Length = 817 Score = 25.4 bits (53), Expect = 7.7 Identities = 10/27 (37%), Positives = 16/27 (59%) Frame = +3 Query: 420 AQFYLWSRHSKGHINRSLNYTSTLLST 500 A++YLW RH +N +L L+S+ Sbjct: 713 ARYYLWRRHFAESLNATLKAYRILISS 739 >SPBC19C7.11 |||ClC chloride channel |Schizosaccharomyces pombe|chr 2|||Manual Length = 812 Score = 25.4 bits (53), Expect = 7.7 Identities = 9/24 (37%), Positives = 14/24 (58%) Frame = +1 Query: 181 PLTAM*VQNCLTLPSFGMVWYVLV 252 P+T + N +T+PS G W L+ Sbjct: 621 PITEVMASNLITIPSIGFTWRKLL 644 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,537,040 Number of Sequences: 5004 Number of extensions: 49815 Number of successful extensions: 85 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 84 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 85 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 313902888 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -