BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0805 (681 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U97189-9|AAC48161.1| 263|Caenorhabditis elegans Hypothetical pr... 28 5.4 U97405-1|AAB53007.1| 327|Caenorhabditis elegans Hypothetical pr... 27 9.4 >U97189-9|AAC48161.1| 263|Caenorhabditis elegans Hypothetical protein C48B6.9 protein. Length = 263 Score = 28.3 bits (60), Expect = 5.4 Identities = 12/24 (50%), Positives = 15/24 (62%), Gaps = 2/24 (8%) Frame = +3 Query: 429 YLWSRHSKGHINRS--LNYTSTLL 494 Y W+ HS GH+ R NY STL+ Sbjct: 240 YFWANHSCGHVYREDCYNYLSTLV 263 >U97405-1|AAB53007.1| 327|Caenorhabditis elegans Hypothetical protein T09B4.5a protein. Length = 327 Score = 27.5 bits (58), Expect = 9.4 Identities = 12/45 (26%), Positives = 24/45 (53%) Frame = +3 Query: 381 PTRESKG*ISFRDAQFYLWSRHSKGHINRSLNYTSTLLSTVFVYL 515 P R ++ + +Q + ++K H + N+ + LLST+F Y+ Sbjct: 178 PVRTTRSASKAQKSQCCAFLTNAKAHAISAYNWIAALLSTIFAYI 222 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,711,011 Number of Sequences: 27780 Number of extensions: 268098 Number of successful extensions: 392 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 386 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 392 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1550199966 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -