BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0800 (665 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_A2EY35 Cluster: Dedicator of cytokinesis family protein... 36 0.88 >UniRef50_A2EY35 Cluster: Dedicator of cytokinesis family protein; n=1; Trichomonas vaginalis G3|Rep: Dedicator of cytokinesis family protein - Trichomonas vaginalis G3 Length = 1559 Score = 35.9 bits (79), Expect = 0.88 Identities = 27/95 (28%), Positives = 47/95 (49%), Gaps = 2/95 (2%) Frame = +1 Query: 64 INNNLCTSVCFSLSLSFSQHIYIYYITF**ERFHMTSDLRAIKKNYKLSTL--KECRNVY 237 IN++LC+ +CF+L SF +I F E +M L K+ K++ + + CR + Sbjct: 737 INDSLCSFICFTLKPSFFYITIANHINFKKEFNNMIKFLLG-HKDQKINHIIRRVCRGII 795 Query: 238 FSSETQGRIYSVKIALQFRCCLFCLFSGVSTSTLP 342 +T Y K+A + CL + ++T+ LP Sbjct: 796 KCCQT----YEPKVAREVSDCLLPILIDLNTNALP 826 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 515,561,267 Number of Sequences: 1657284 Number of extensions: 9258702 Number of successful extensions: 17540 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 16985 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 17533 length of database: 575,637,011 effective HSP length: 98 effective length of database: 413,223,179 effective search space used: 50826451017 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -