BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0800 (665 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY069244-1|AAL39389.1| 246|Drosophila melanogaster GM01936p pro... 29 7.5 AE014134-1811|AAF52894.2| 246|Drosophila melanogaster CG4957-PA... 29 7.5 >AY069244-1|AAL39389.1| 246|Drosophila melanogaster GM01936p protein. Length = 246 Score = 28.7 bits (61), Expect = 7.5 Identities = 18/61 (29%), Positives = 29/61 (47%), Gaps = 5/61 (8%) Frame = +1 Query: 181 RAIKKNYKLSTLKECRNVYFSSETQGRIYSVKIALQFRCCLFCL-----FSGVSTSTLPR 345 RA+K+N T++ N + +S+ Q + Y + I + L C+ FSGV P Sbjct: 56 RALKQNMPSGTIQNTLNKFKASKVQLKKYRLDIKYKRNVYLICIFYTDNFSGVKMDATPM 115 Query: 346 I 348 I Sbjct: 116 I 116 >AE014134-1811|AAF52894.2| 246|Drosophila melanogaster CG4957-PA protein. Length = 246 Score = 28.7 bits (61), Expect = 7.5 Identities = 18/61 (29%), Positives = 29/61 (47%), Gaps = 5/61 (8%) Frame = +1 Query: 181 RAIKKNYKLSTLKECRNVYFSSETQGRIYSVKIALQFRCCLFCL-----FSGVSTSTLPR 345 RA+K+N T++ N + +S+ Q + Y + I + L C+ FSGV P Sbjct: 56 RALKQNMPSGTIQNTLNKFKASKVQLKKYRLDIKYKRNVYLICIFYTDNFSGVKMDATPM 115 Query: 346 I 348 I Sbjct: 116 I 116 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 23,194,163 Number of Sequences: 53049 Number of extensions: 425973 Number of successful extensions: 837 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 827 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 837 length of database: 24,988,368 effective HSP length: 82 effective length of database: 20,638,350 effective search space used: 2868730650 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -