BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0794 (831 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 08_01_0620 - 5416197-5416225,5416333-5416652,5417144-5417235,541... 28 7.9 06_01_0485 - 3444240-3444398,3444507-3444572,3444644-3444724,344... 28 7.9 >08_01_0620 - 5416197-5416225,5416333-5416652,5417144-5417235, 5417304-5417394,5417489-5417577,5417812-5417929, 5418007-5418098,5418180-5418215,5418323-5418403, 5418510-5418617,5418809-5418901,5419045-5419146, 5419345-5419449,5419526-5419612,5419952-5420227 Length = 572 Score = 28.3 bits (60), Expect = 7.9 Identities = 16/34 (47%), Positives = 19/34 (55%) Frame = +1 Query: 235 KEMELCDNDYRGYNTLTLQYKTKLGDSVTGGQRR 336 K +EL +D GYN + K K GDS GG RR Sbjct: 471 KALELSGSDLGGYNLYVDEAKPK-GDSRDGGGRR 503 >06_01_0485 - 3444240-3444398,3444507-3444572,3444644-3444724, 3444823-3444900,3444980-3445075,3445363-3445405, 3445498-3445571,3445693-3445781,3445887-3445935, 3446171-3446227,3446309-3446425,3448633-3448698, 3449140-3449196,3449271-3449363,3449515-3449662, 3449753-3449902,3449979-3450181,3450319-3450438, 3450530-3450694,3450784-3450870,3450951-3451100, 3451225-3451365,3451399-3451569,3452015-3452091, 3452175-3452415,3452495-3452758,3452913-3453000, 3453099-3453481 Length = 1170 Score = 28.3 bits (60), Expect = 7.9 Identities = 13/39 (33%), Positives = 19/39 (48%) Frame = +1 Query: 253 DNDYRGYNTLTLQYKTKLGDSVTGGQRRPIIALGKAIHR 369 D DY G+ TL Y KLG V + ++ + IH+ Sbjct: 173 DYDYFGFKTLERSYLLKLGGKVVERPQHMLMRVSVGIHK 211 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,606,642 Number of Sequences: 37544 Number of extensions: 324793 Number of successful extensions: 449 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 446 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 449 length of database: 14,793,348 effective HSP length: 81 effective length of database: 11,752,284 effective search space used: 2291695380 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -