BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0781 (485 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g02760.1 68417.m00376 F-box family protein contains Pfam PF00... 30 0.72 >At4g02760.1 68417.m00376 F-box family protein contains Pfam PF00646: F-box domain; similar to leucine-rich repeats containing F-box protein FBL3 (GI:5919219) [Homo sapiens] Length = 419 Score = 30.3 bits (65), Expect = 0.72 Identities = 25/85 (29%), Positives = 36/85 (42%), Gaps = 2/85 (2%) Frame = +3 Query: 231 IYKSKKILVISKLCLSNC*KL*VIYSLTFKLFIRFHVLFRSLTQQSCICIKLNK--SDVI 404 +YKS K + + L N ++ LT K+F +SL Q S C NK D + Sbjct: 97 LYKSTKRCIRKRATLQNSTSWPLLPELTIKVFSMLDT--KSLMQASACCTMFNKCAMDRV 154 Query: 405 *FSHFSESEPILNVKKGT*IVNIFR 479 +SH + +V G V I R Sbjct: 155 CYSHIDLTTAAEDVDNGVVCVMIHR 179 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 7,365,477 Number of Sequences: 28952 Number of extensions: 115519 Number of successful extensions: 186 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 183 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 186 length of database: 12,070,560 effective HSP length: 76 effective length of database: 9,870,208 effective search space used: 838967680 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -