BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0780 (781 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB193550-1|BAD66824.1| 699|Apis mellifera soluble guanylyl cycl... 25 1.0 EF625898-1|ABR45905.1| 686|Apis mellifera hexamerin protein. 23 2.4 EF589162-1|ABQ84439.1| 686|Apis mellifera hexamerin 70c protein. 23 2.4 DQ869051-1|ABJ09598.1| 581|Apis mellifera pyrokinin-like recept... 23 2.4 AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecul... 23 2.4 AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member A... 23 2.4 AM050259-1|CAJ18340.1| 683|Apis mellifera putative H3K9 methylt... 22 5.6 AB270697-1|BAF75928.1| 735|Apis mellifera FoxP protein protein. 22 5.6 DQ869053-1|ABJ09600.1| 459|Apis mellifera capa-like receptor pr... 21 9.7 DQ667186-1|ABG75738.1| 447|Apis mellifera glutamate-gated chlor... 21 9.7 DQ667185-1|ABG75737.1| 447|Apis mellifera glutamate-gated chlor... 21 9.7 DQ201783-1|ABB05503.1| 381|Apis mellifera capa receptor-like GP... 21 9.7 >AB193550-1|BAD66824.1| 699|Apis mellifera soluble guanylyl cyclase alpha 1 subunit protein. Length = 699 Score = 24.6 bits (51), Expect = 1.0 Identities = 11/27 (40%), Positives = 16/27 (59%) Frame = +1 Query: 148 STALPKMVINVDLKGFEEFSKYTRAID 228 STA P MVIN+ +E+F + +D Sbjct: 505 STATPMMVINMLQNLYEQFDSFCGQLD 531 >EF625898-1|ABR45905.1| 686|Apis mellifera hexamerin protein. Length = 686 Score = 23.4 bits (48), Expect = 2.4 Identities = 9/17 (52%), Positives = 12/17 (70%) Frame = -1 Query: 433 SDCPF*TGTLCPSNILY 383 S+ PF T T+ PS+I Y Sbjct: 564 SESPFTTSTIMPSDIFY 580 >EF589162-1|ABQ84439.1| 686|Apis mellifera hexamerin 70c protein. Length = 686 Score = 23.4 bits (48), Expect = 2.4 Identities = 9/17 (52%), Positives = 12/17 (70%) Frame = -1 Query: 433 SDCPF*TGTLCPSNILY 383 S+ PF T T+ PS+I Y Sbjct: 564 SESPFTTSTIMPSDIFY 580 >DQ869051-1|ABJ09598.1| 581|Apis mellifera pyrokinin-like receptor 2 protein. Length = 581 Score = 23.4 bits (48), Expect = 2.4 Identities = 9/18 (50%), Positives = 13/18 (72%) Frame = +2 Query: 245 YFFTLAVQNYLMAIAGAP 298 Y F+LAV + L+ I+G P Sbjct: 91 YLFSLAVSDLLLLISGLP 108 >AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecule AbsCAM-Ig7B protein. Length = 1923 Score = 23.4 bits (48), Expect = 2.4 Identities = 11/29 (37%), Positives = 18/29 (62%), Gaps = 2/29 (6%) Frame = +1 Query: 376 VGD--REYWKDKECPFRTDSRSKLMVIPT 456 VGD RE++K + RTDS + ++P+ Sbjct: 1338 VGDPTREWYKGQGEQIRTDSTRNIQILPS 1366 >AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member AbsCAM-Ig7A protein. Length = 1919 Score = 23.4 bits (48), Expect = 2.4 Identities = 11/29 (37%), Positives = 18/29 (62%), Gaps = 2/29 (6%) Frame = +1 Query: 376 VGD--REYWKDKECPFRTDSRSKLMVIPT 456 VGD RE++K + RTDS + ++P+ Sbjct: 1334 VGDPTREWYKGQGEQIRTDSTRNIQILPS 1362 >AM050259-1|CAJ18340.1| 683|Apis mellifera putative H3K9 methyltransferase protein. Length = 683 Score = 22.2 bits (45), Expect = 5.6 Identities = 13/43 (30%), Positives = 18/43 (41%) Frame = +1 Query: 172 INVDLKGFEEFSKYTRAIDSRGPPVFFYFSGSKLPDGNSWCPD 300 +N+ KG + + ID G P FY+ LP PD Sbjct: 388 MNIITKG-KPLIRVENIIDLEGAPQNFYYIEEYLPGNGVIIPD 429 >AB270697-1|BAF75928.1| 735|Apis mellifera FoxP protein protein. Length = 735 Score = 22.2 bits (45), Expect = 5.6 Identities = 10/36 (27%), Positives = 15/36 (41%) Frame = -2 Query: 669 IY*WLLEELKYFMVDNIIYSYVIVGNLSIRICLKRI 562 IY W YF + + + NLS+ C R+ Sbjct: 530 IYNWFQNTFCYFRRNAATWKNAVRHNLSLHKCFMRV 565 >DQ869053-1|ABJ09600.1| 459|Apis mellifera capa-like receptor protein. Length = 459 Score = 21.4 bits (43), Expect = 9.7 Identities = 9/18 (50%), Positives = 10/18 (55%) Frame = +2 Query: 245 YFFTLAVQNYLMAIAGAP 298 Y F LAV + L I G P Sbjct: 71 YLFNLAVSDLLFLILGLP 88 >DQ667186-1|ABG75738.1| 447|Apis mellifera glutamate-gated chloride channel protein. Length = 447 Score = 21.4 bits (43), Expect = 9.7 Identities = 9/16 (56%), Positives = 11/16 (68%) Frame = +2 Query: 35 IILPNALYRIFINFSI 82 II+PN RIF N S+ Sbjct: 133 IIMPNVYIRIFPNGSV 148 >DQ667185-1|ABG75737.1| 447|Apis mellifera glutamate-gated chloride channel protein. Length = 447 Score = 21.4 bits (43), Expect = 9.7 Identities = 9/16 (56%), Positives = 11/16 (68%) Frame = +2 Query: 35 IILPNALYRIFINFSI 82 II+PN RIF N S+ Sbjct: 133 IIMPNVYIRIFPNGSV 148 >DQ201783-1|ABB05503.1| 381|Apis mellifera capa receptor-like GPCR protein. Length = 381 Score = 21.4 bits (43), Expect = 9.7 Identities = 7/23 (30%), Positives = 13/23 (56%) Frame = +2 Query: 245 YFFTLAVQNYLMAIAGAPTAWKL 313 Y F+LA+ + ++ + G P L Sbjct: 78 YLFSLAISDLILLVLGLPNELSL 100 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 207,315 Number of Sequences: 438 Number of extensions: 4605 Number of successful extensions: 16 Number of sequences better than 10.0: 12 Number of HSP's better than 10.0 without gapping: 16 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 16 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 24518154 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -