BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0779 (652 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY052625-1|AAL15473.1| 135|Tribolium castaneum tryptophan oxyge... 26 0.31 AY052392-1|AAL15466.1| 388|Tribolium castaneum tryptophan oxyge... 26 0.31 AY052390-1|AAL15464.1| 388|Tribolium castaneum tryptophan oxyge... 26 0.31 AF217810-1|AAF71998.1| 431|Tribolium castaneum fork head orthol... 24 1.2 EF222296-1|ABN79656.2| 403|Tribolium castaneum arginine vasopre... 21 8.8 EF125544-1|ABL73928.1| 279|Tribolium castaneum obstractor B pro... 21 8.8 >AY052625-1|AAL15473.1| 135|Tribolium castaneum tryptophan oxygenase protein. Length = 135 Score = 25.8 bits (54), Expect = 0.31 Identities = 10/21 (47%), Positives = 12/21 (57%) Frame = +3 Query: 237 DYHDFKTYRRPARGLPKLSMR 299 D+ DF+ Y RPA G L R Sbjct: 59 DFMDFRCYLRPASGFQSLQFR 79 >AY052392-1|AAL15466.1| 388|Tribolium castaneum tryptophan oxygenase protein. Length = 388 Score = 25.8 bits (54), Expect = 0.31 Identities = 10/21 (47%), Positives = 12/21 (57%) Frame = +3 Query: 237 DYHDFKTYRRPARGLPKLSMR 299 D+ DF+ Y RPA G L R Sbjct: 119 DFMDFRCYLRPASGFQSLQFR 139 >AY052390-1|AAL15464.1| 388|Tribolium castaneum tryptophan oxygenase protein. Length = 388 Score = 25.8 bits (54), Expect = 0.31 Identities = 10/21 (47%), Positives = 12/21 (57%) Frame = +3 Query: 237 DYHDFKTYRRPARGLPKLSMR 299 D+ DF+ Y RPA G L R Sbjct: 119 DFMDFRCYLRPASGFQSLQFR 139 >AF217810-1|AAF71998.1| 431|Tribolium castaneum fork head orthologue protein. Length = 431 Score = 23.8 bits (49), Expect = 1.2 Identities = 12/30 (40%), Positives = 16/30 (53%) Frame = -1 Query: 436 LSKRTDH**VHHHNRIFRRTKERPSRGTPS 347 LS +DH + HHN + K+ PS T S Sbjct: 337 LSLSSDHQAMLHHNPMSHHLKQEPSGFTSS 366 >EF222296-1|ABN79656.2| 403|Tribolium castaneum arginine vasopressin receptor protein. Length = 403 Score = 21.0 bits (42), Expect = 8.8 Identities = 9/15 (60%), Positives = 11/15 (73%) Frame = +3 Query: 273 RGLPKLSMRHSTHSS 317 R LP+L +RH T SS Sbjct: 324 RELPRLLLRHYTASS 338 >EF125544-1|ABL73928.1| 279|Tribolium castaneum obstractor B protein. Length = 279 Score = 21.0 bits (42), Expect = 8.8 Identities = 7/15 (46%), Positives = 10/15 (66%) Frame = -1 Query: 577 FRDYTADDE*CQTPF 533 F DY+++ E C PF Sbjct: 74 FNDYSSEYEKCDLPF 88 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 154,038 Number of Sequences: 336 Number of extensions: 3366 Number of successful extensions: 11 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 11 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 16760905 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -