BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0775 (809 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_48634| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.16 SB_40971| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.48 SB_51988| Best HMM Match : bZIP_2 (HMM E-Value=7.3e-13) 32 0.48 SB_1658| Best HMM Match : Pox_A_type_inc (HMM E-Value=0.16) 32 0.48 SB_10144| Best HMM Match : Extensin_2 (HMM E-Value=0.79) 31 0.84 SB_23780| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.1 SB_40542| Best HMM Match : B3_4 (HMM E-Value=0) 31 1.5 SB_18951| Best HMM Match : EGF (HMM E-Value=2.1e-06) 30 1.9 SB_25422| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.9 SB_53804| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.6 SB_39495| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.6 SB_28720| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.6 SB_45061| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.6 SB_8680| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.6 SB_15397| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.4 SB_9567| Best HMM Match : CASP_C (HMM E-Value=2.8e-07) 29 3.4 SB_6699| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.4 SB_44617| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.5 SB_51968| Best HMM Match : PT (HMM E-Value=0.54) 29 4.5 SB_1657| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.5 SB_52297| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.9 SB_12027| Best HMM Match : Extensin_2 (HMM E-Value=0.2) 29 5.9 SB_9407| Best HMM Match : DCX (HMM E-Value=2.6) 29 5.9 SB_21614| Best HMM Match : RVT_1 (HMM E-Value=1.10002e-41) 28 7.8 SB_10953| Best HMM Match : HALZ (HMM E-Value=0.25) 28 7.8 SB_4485| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.8 SB_113| Best HMM Match : HALZ (HMM E-Value=0.32) 28 7.8 SB_53197| Best HMM Match : TP2 (HMM E-Value=5.8) 28 7.8 SB_50134| Best HMM Match : Sorting_nexin (HMM E-Value=6.3) 28 7.8 SB_40295| Best HMM Match : HALZ (HMM E-Value=0.25) 28 7.8 SB_33966| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.8 SB_31204| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.8 SB_26360| Best HMM Match : PKD_channel (HMM E-Value=1.3e-30) 28 7.8 SB_23367| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.8 SB_19444| Best HMM Match : zf-C3HC4 (HMM E-Value=0.011) 28 7.8 >SB_48634| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1066 Score = 33.9 bits (74), Expect = 0.16 Identities = 28/109 (25%), Positives = 47/109 (43%), Gaps = 3/109 (2%) Frame = +3 Query: 303 LHPDPSWNQRKRPIPRNLKKISPVPE--PRSNYTPARKISPIQNLNKSPVKGNQEPVRNG 476 L P+PS N P + +P P P ++ P+ +SP N NK+ +G + N Sbjct: 625 LSPNPSPNPSTSPYRNHSSNTNPNPSLGPNPSHNPSFSLSPNPNQNKTQGEGERATTMN- 683 Query: 477 VVKTKKPLKKSN-QYTLDNCPDTLVCDTKGSNTDHFGLRQRRHSLPVDL 620 T+K LK ++ + L T S TD L+ R ++ ++ Sbjct: 684 --DTQKGLKVDGVGFSQKHFDANLKGTTLASTTDSDNLQDRFGTISTEI 730 >SB_40971| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 828 Score = 32.3 bits (70), Expect = 0.48 Identities = 17/71 (23%), Positives = 31/71 (43%) Frame = +3 Query: 300 ILHPDPSWNQRKRPIPRNLKKISPVPEPRSNYTPARKISPIQNLNKSPVKGNQEPVRNGV 479 IL + +W + + + K +PV SN + ++P +NL+ P+ + N Sbjct: 537 ILSGNSTWKRNNASVMSEINKPAPVENQGSNIEIGKLVTPTRNLSGMPMSRSPNYGNNAN 596 Query: 480 VKTKKPLKKSN 512 VK K +N Sbjct: 597 VKDNLKQKSNN 607 >SB_51988| Best HMM Match : bZIP_2 (HMM E-Value=7.3e-13) Length = 244 Score = 32.3 bits (70), Expect = 0.48 Identities = 14/35 (40%), Positives = 24/35 (68%) Frame = +3 Query: 651 RMQNLEVENVMLKNELNVLNREVADLLEKLRKTQD 755 R QNLE+EN L+NE+ +L + + L KL ++++ Sbjct: 209 RAQNLEIENEKLRNEVTMLKKRLQTLNGKLDESEN 243 >SB_1658| Best HMM Match : Pox_A_type_inc (HMM E-Value=0.16) Length = 458 Score = 32.3 bits (70), Expect = 0.48 Identities = 15/48 (31%), Positives = 30/48 (62%) Frame = +3 Query: 651 RMQNLEVENVMLKNELNVLNREVADLLEKLRKTQDGNKVEKVANGHAE 794 R+ NLE+EN +L+ E++ LN E ++ +L++ +D K + + H + Sbjct: 20 RVSNLELENKLLRKEVSSLNEE---MVSQLQRAKDAEKRAQETDRHLD 64 >SB_10144| Best HMM Match : Extensin_2 (HMM E-Value=0.79) Length = 701 Score = 31.5 bits (68), Expect = 0.84 Identities = 16/42 (38%), Positives = 20/42 (47%) Frame = +3 Query: 267 VKARKQENSDFILHPDPSWNQRKRPIPRNLKKISPVPEPRSN 392 VK QE + I+ P P + P PR K PVP PR + Sbjct: 234 VKQMAQEYEENIIPPPPEFLGTAVPAPRTYKPRPPVPTPRKS 275 >SB_23780| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 155 Score = 31.1 bits (67), Expect = 1.1 Identities = 15/37 (40%), Positives = 23/37 (62%), Gaps = 1/37 (2%) Frame = +3 Query: 417 PIQNLNKSPVK-GNQEPVRNGVVKTKKPLKKSNQYTL 524 P++N+N P++ GN EP+RN KPL+ N +L Sbjct: 99 PLRNVNNKPLRTGNNEPLRN---VNNKPLRTGNNESL 132 >SB_40542| Best HMM Match : B3_4 (HMM E-Value=0) Length = 325 Score = 30.7 bits (66), Expect = 1.5 Identities = 24/95 (25%), Positives = 39/95 (41%), Gaps = 4/95 (4%) Frame = +3 Query: 291 SDFILHPDPSWNQRKRPIPRNLKKISPVPEPR----SNYTPARKISPIQNLNKSPVKGNQ 458 SD + P P+W Q + LK I P+ +NY P+ + + +KGN+ Sbjct: 112 SDLTVKPSPAWLQNR------LKAIGLSPKNNIVDVTNYVLHELGQPLHAFDANKIKGNK 165 Query: 459 EPVRNGVVKTKKPLKKSNQYTLDNCPDTLVCDTKG 563 ++ TK + TLD D ++C G Sbjct: 166 VVIKTVAAGTKFTTLDDVERTLD-ADDLMICHADG 199 >SB_18951| Best HMM Match : EGF (HMM E-Value=2.1e-06) Length = 1223 Score = 30.3 bits (65), Expect = 1.9 Identities = 20/54 (37%), Positives = 27/54 (50%), Gaps = 2/54 (3%) Frame = +3 Query: 312 DPSWNQRKRPIPRNLKKISPVPEPRSNY-TPARKISPIQNLNKS-PVKGNQEPV 467 D S + R + +K SP P PRS+ T +RK+S + S P G Q PV Sbjct: 344 DQSSHSSPRNSRNSSRKSSPKPSPRSSRPTSSRKLSRKSSRKSSRPTSGQQSPV 397 >SB_25422| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 258 Score = 30.3 bits (65), Expect = 1.9 Identities = 18/57 (31%), Positives = 29/57 (50%) Frame = +3 Query: 372 VPEPRSNYTPARKISPIQNLNKSPVKGNQEPVRNGVVKTKKPLKKSNQYTLDNCPDT 542 VP P YTP R + QNL +S ++ + E + KK KK+ Q + + P++ Sbjct: 135 VPTPPLAYTPVRSLKEEQNLRES-LQASVEESLESHEQEKKAKKKNKQPKIKHEPES 190 >SB_53804| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 522 Score = 29.9 bits (64), Expect = 2.6 Identities = 11/28 (39%), Positives = 17/28 (60%) Frame = +3 Query: 369 PVPEPRSNYTPARKISPIQNLNKSPVKG 452 P+ EP Y P ++ P + LN+ P+KG Sbjct: 344 PIKEPYHVYEPGDQVLPPEELNEEPLKG 371 >SB_39495| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 162 Score = 29.9 bits (64), Expect = 2.6 Identities = 19/69 (27%), Positives = 29/69 (42%) Frame = +3 Query: 213 LLNNLDEQTGAALRNHNVVKARKQENSDFILHPDPSWNQRKRPIPRNLKKISPVPEPRSN 392 L + + Q+ H + K+ K EN +L RNL + SP PR + Sbjct: 45 LSSEMSHQSKTHANTHYLKKSPKGENQKTMLKIPVGGTLGALSSVRNLSQPSPAKRPRPS 104 Query: 393 YTPARKISP 419 + A KI+P Sbjct: 105 RSKANKINP 113 >SB_28720| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 672 Score = 29.9 bits (64), Expect = 2.6 Identities = 12/44 (27%), Positives = 23/44 (52%) Frame = +3 Query: 333 KRPIPRNLKKISPVPEPRSNYTPARKISPIQNLNKSPVKGNQEP 464 KR +P+ K + P E ++ T +SP++ +N+ + EP Sbjct: 495 KRTVPKTAKDVLPPEETKTEVTTKEIVSPVKEVNELHREPETEP 538 >SB_45061| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 222 Score = 29.9 bits (64), Expect = 2.6 Identities = 19/69 (27%), Positives = 29/69 (42%) Frame = +3 Query: 213 LLNNLDEQTGAALRNHNVVKARKQENSDFILHPDPSWNQRKRPIPRNLKKISPVPEPRSN 392 L + + Q+ H + K+ K EN +L RNL + SP PR + Sbjct: 45 LSSEMSHQSKTHANTHYLKKSPKGENQKTMLKIPVGGTLGALSSVRNLSQPSPAKRPRPS 104 Query: 393 YTPARKISP 419 + A KI+P Sbjct: 105 RSKANKINP 113 >SB_8680| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2462 Score = 29.9 bits (64), Expect = 2.6 Identities = 16/48 (33%), Positives = 24/48 (50%) Frame = +3 Query: 423 QNLNKSPVKGNQEPVRNGVVKTKKPLKKSNQYTLDNCPDTLVCDTKGS 566 Q + SP+ G++ R +K PLKK + T + P T +C T S Sbjct: 1873 QRVPVSPISGSKSSTRT--IKEPLPLKKRHLKTFQDTPVTDMCSTTSS 1918 >SB_15397| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 221 Score = 29.5 bits (63), Expect = 3.4 Identities = 11/41 (26%), Positives = 25/41 (60%) Frame = +3 Query: 633 DEEWTYRMQNLEVENVMLKNELNVLNREVADLLEKLRKTQD 755 +E + R LE+EN LK+E+N + +++ + +++ +D Sbjct: 8 NESMSARNAQLEIENESLKSEVNTMKTDLSSMHSDMKEARD 48 >SB_9567| Best HMM Match : CASP_C (HMM E-Value=2.8e-07) Length = 434 Score = 29.5 bits (63), Expect = 3.4 Identities = 19/78 (24%), Positives = 35/78 (44%), Gaps = 2/78 (2%) Frame = +3 Query: 216 LNNLDEQTGAALRNHNVVKARKQENSDFILHPDPSWNQRKR--PIPRNLKKISPVPEPRS 389 L NL+ + G++LR+ +R + L P ++NQR + P +++S P P + Sbjct: 272 LRNLELEAGSSLRDDEAAVSRYSSQYEQRLDPFAAFNQRGKSYPFAAFNQRVSLTPLPPN 331 Query: 390 NYTPARKISPIQNLNKSP 443 + P Q +P Sbjct: 332 QRVSLTHLPPNQRGKSNP 349 >SB_6699| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1087 Score = 29.5 bits (63), Expect = 3.4 Identities = 11/41 (26%), Positives = 25/41 (60%) Frame = +3 Query: 633 DEEWTYRMQNLEVENVMLKNELNVLNREVADLLEKLRKTQD 755 +E + R LE+EN LK+E+N + +++ + +++ +D Sbjct: 174 NESMSARNAQLEIENESLKSEVNTMKTDLSSMHSDMKEARD 214 >SB_44617| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 76 Score = 29.1 bits (62), Expect = 4.5 Identities = 15/29 (51%), Positives = 16/29 (55%) Frame = +3 Query: 432 NKSPVKGNQEPVRNGVVKTKKPLKKSNQY 518 NK PV Q P N +V T PLKKS Y Sbjct: 30 NKRPVVRIQHPSPNAIVLTLTPLKKSLVY 58 >SB_51968| Best HMM Match : PT (HMM E-Value=0.54) Length = 514 Score = 29.1 bits (62), Expect = 4.5 Identities = 13/62 (20%), Positives = 27/62 (43%) Frame = +3 Query: 264 VVKARKQENSDFILHPDPSWNQRKRPIPRNLKKISPVPEPRSNYTPARKISPIQNLNKSP 443 V + ++ E+ + + P P ++RP R K + P E + TP + + + P Sbjct: 119 VTEVQEIEHEEIYVTPKPKTTVKRRPTERPTKSLLPEEEEKERQTPTPTKAKPTTIKRRP 178 Query: 444 VK 449 + Sbjct: 179 TE 180 >SB_1657| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 190 Score = 29.1 bits (62), Expect = 4.5 Identities = 12/26 (46%), Positives = 17/26 (65%) Frame = +3 Query: 174 MAWFADLAGKAETLLNNLDEQTGAAL 251 M+WF++LA KAE+LL +D L Sbjct: 1 MSWFSELAVKAESLLEKVDNTAANVL 26 >SB_52297| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 28.7 bits (61), Expect = 5.9 Identities = 17/42 (40%), Positives = 21/42 (50%), Gaps = 1/42 (2%) Frame = +3 Query: 495 PLKKSNQYTLDNCPDTLVCDTKGSNTDHF-GLRQRRHSLPVD 617 P KK YTL P++L G DHF + +R H PVD Sbjct: 42 PFKK--MYTLTGKPNSLHDSADGEEDDHFLKVIKRAHETPVD 81 >SB_12027| Best HMM Match : Extensin_2 (HMM E-Value=0.2) Length = 1706 Score = 28.7 bits (61), Expect = 5.9 Identities = 38/152 (25%), Positives = 50/152 (32%), Gaps = 6/152 (3%) Frame = +3 Query: 303 LHPDPSWNQRKRPIPRNLKKISPVPEPRSNYTPARKISPIQNLNKSPVKGNQEPVRNGVV 482 +H P R + K P N RKISP Q+ Q P + Sbjct: 906 IHDVPRSTSRSQRKDLGGKSDRPRSADNRNKRDKRKISPAQSGQSGKTSNKQSPRQTSRR 965 Query: 483 KTKKPLKKSNQYTLDNCP---DTLVCDTKGSNTDH--FGLRQRRHSLPVDLEIVSDEEWT 647 K + + L N VC G T H ++RH LP LE D + Sbjct: 966 KRPNTEEVDLSHKLTNRKRQRKVTVCGPSGVQTTHAKSSESEKRHGLP-RLE-RKDNAGS 1023 Query: 648 YRMQNLEVENVML-KNELNVLNREVADLLEKL 740 Y Q EV ++ E +V DL L Sbjct: 1024 YPRQGSEVSSIDTGDREFSVGKERALDLKNSL 1055 >SB_9407| Best HMM Match : DCX (HMM E-Value=2.6) Length = 306 Score = 28.7 bits (61), Expect = 5.9 Identities = 13/32 (40%), Positives = 19/32 (59%) Frame = -1 Query: 497 GFLRFYNSISYWLLIAFYRRFIQILYRRNLSS 402 GF F ++ ++AF RRFI ++YR SS Sbjct: 267 GFPAFQIRSKFFAMLAFRRRFIYLVYRLTTSS 298 >SB_21614| Best HMM Match : RVT_1 (HMM E-Value=1.10002e-41) Length = 1047 Score = 28.3 bits (60), Expect = 7.8 Identities = 13/31 (41%), Positives = 20/31 (64%) Frame = +3 Query: 651 RMQNLEVENVMLKNELNVLNREVADLLEKLR 743 ++ LE EN L+ E NVLN ++ + +KLR Sbjct: 29 KVTTLERENEALRVENNVLNSRISTITDKLR 59 >SB_10953| Best HMM Match : HALZ (HMM E-Value=0.25) Length = 319 Score = 28.3 bits (60), Expect = 7.8 Identities = 13/31 (41%), Positives = 20/31 (64%) Frame = +3 Query: 651 RMQNLEVENVMLKNELNVLNREVADLLEKLR 743 ++ LE EN L+ E NVLN ++ + +KLR Sbjct: 163 KVTTLERENEALRVENNVLNSRISTITDKLR 193 >SB_4485| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1769 Score = 28.3 bits (60), Expect = 7.8 Identities = 16/51 (31%), Positives = 33/51 (64%), Gaps = 2/51 (3%) Frame = +3 Query: 636 EEWTYRMQNLEVENVMLKNELNVLNREVADLLEKLRKTQDGN--KVEKVAN 782 ++W R L + +V+ + LN+++ EVA+LL +++ ++ N + EKV+N Sbjct: 212 KDWEIRGVQLCMGSVVDADLLNLVSGEVANLLAEVQTAKESNEEESEKVSN 262 >SB_113| Best HMM Match : HALZ (HMM E-Value=0.32) Length = 255 Score = 28.3 bits (60), Expect = 7.8 Identities = 13/31 (41%), Positives = 20/31 (64%) Frame = +3 Query: 651 RMQNLEVENVMLKNELNVLNREVADLLEKLR 743 ++ LE EN L+ E NVLN ++ + +KLR Sbjct: 29 KVTTLERENEALRVENNVLNSRISTITDKLR 59 >SB_53197| Best HMM Match : TP2 (HMM E-Value=5.8) Length = 217 Score = 28.3 bits (60), Expect = 7.8 Identities = 15/46 (32%), Positives = 26/46 (56%) Frame = +2 Query: 296 FYLTSRPFLEPKKKANTTKFKENFTRSRATFKLHSCSKDFSYTEFE 433 F+ S+ L +++ T+K T R+T +LH CS D +T+F+ Sbjct: 146 FFSVSKEMLASRRR-QTSKAWRTTTHGRSTEQLHHCS-DCYFTQFD 189 >SB_50134| Best HMM Match : Sorting_nexin (HMM E-Value=6.3) Length = 310 Score = 28.3 bits (60), Expect = 7.8 Identities = 10/29 (34%), Positives = 16/29 (55%) Frame = +3 Query: 309 PDPSWNQRKRPIPRNLKKISPVPEPRSNY 395 P P+ Q+ P PRN ++ P P P+ + Sbjct: 179 PKPAHRQKPVPAPRNKPELKPKPVPKPRF 207 >SB_40295| Best HMM Match : HALZ (HMM E-Value=0.25) Length = 477 Score = 28.3 bits (60), Expect = 7.8 Identities = 13/31 (41%), Positives = 20/31 (64%) Frame = +3 Query: 651 RMQNLEVENVMLKNELNVLNREVADLLEKLR 743 ++ LE EN L+ E NVLN ++ + +KLR Sbjct: 244 KVTTLERENEALRVENNVLNSRISTITDKLR 274 >SB_33966| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 359 Score = 28.3 bits (60), Expect = 7.8 Identities = 17/46 (36%), Positives = 26/46 (56%) Frame = +3 Query: 657 QNLEVENVMLKNELNVLNREVADLLEKLRKTQDGNKVEKVANGHAE 794 +NL EN++LK ELN L E+ K+ QD ++E++ N E Sbjct: 113 ENLMNENLLLKAELNKLKYELKVKDNKIESLQD--ELERMENEKTE 156 >SB_31204| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 975 Score = 28.3 bits (60), Expect = 7.8 Identities = 22/79 (27%), Positives = 32/79 (40%), Gaps = 8/79 (10%) Frame = +3 Query: 318 SWNQRKRPIPRN---LKKISPVPEPRSNYTPARKISPIQNLNKSPVKGN---QEPVRNGV 479 +W K+PIP N + + R + P+ + P PV+GN Q P R G Sbjct: 641 AWGMHKKPIPANYFPAQMLLTEIGARGDLIPSAQRRPFVCKGPGPVRGNATSQPPRREGT 700 Query: 480 VKTKKPLKK--SNQYTLDN 530 + L K + Q T N Sbjct: 701 IALGSTLMKKFAQQRTASN 719 >SB_26360| Best HMM Match : PKD_channel (HMM E-Value=1.3e-30) Length = 3015 Score = 28.3 bits (60), Expect = 7.8 Identities = 20/63 (31%), Positives = 28/63 (44%) Frame = +2 Query: 320 LEPKKKANTTKFKENFTRSRATFKLHSCSKDFSYTEFE*ISCKRQSRASKKWSCKNEETL 499 ++P K F F R RAT L S K+ + + R+S +S NEE L Sbjct: 2069 IQPLKICILAIFLSCFFRKRATKDLVSGPKELIHVQETIPGQSRESANQLSFSVPNEEHL 2128 Query: 500 KKI 508 KK+ Sbjct: 2129 KKV 2131 >SB_23367| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 118 Score = 28.3 bits (60), Expect = 7.8 Identities = 15/38 (39%), Positives = 23/38 (60%) Frame = +3 Query: 357 KKISPVPEPRSNYTPARKISPIQNLNKSPVKGNQEPVR 470 K S +P+ +S++ RKIS ++ +NKSP K VR Sbjct: 56 KHTSSIPDWKSSHAE-RKISVVERVNKSPHKWQDFKVR 92 >SB_19444| Best HMM Match : zf-C3HC4 (HMM E-Value=0.011) Length = 434 Score = 28.3 bits (60), Expect = 7.8 Identities = 18/63 (28%), Positives = 34/63 (53%) Frame = +3 Query: 192 LAGKAETLLNNLDEQTGAALRNHNVVKARKQENSDFILHPDPSWNQRKRPIPRNLKKISP 371 LA +AE++LNN+++ T + VVK + Q + + I H ++ + + +N K+S Sbjct: 326 LADEAESILNNMEDTTEQIFQEKKVVK-KLQVDEEEIKH---RISELQNQLAKNKSKLSE 381 Query: 372 VPE 380 E Sbjct: 382 TQE 384 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 23,241,440 Number of Sequences: 59808 Number of extensions: 482065 Number of successful extensions: 1632 Number of sequences better than 10.0: 35 Number of HSP's better than 10.0 without gapping: 1462 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1619 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2251677692 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -