BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0775 (809 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB264313-1|BAF43600.1| 900|Apis mellifera ecdysone-induced prot... 25 0.83 DQ011227-1|AAY63896.1| 484|Apis mellifera Amt-1-like protein pr... 24 1.4 DQ000307-1|AAY21180.1| 423|Apis mellifera major royal jelly pro... 24 1.9 AB161182-1|BAD08344.1| 1040|Apis mellifera metabotropic glutamat... 23 4.4 AJ968562-1|CAI91546.1| 998|Apis mellifera protein ( Apis mellif... 22 7.7 >AB264313-1|BAF43600.1| 900|Apis mellifera ecdysone-induced protein 75 protein. Length = 900 Score = 25.0 bits (52), Expect = 0.83 Identities = 11/24 (45%), Positives = 13/24 (54%) Frame = +3 Query: 345 PRNLKKISPVPEPRSNYTPARKIS 416 P NL K SP P PR P + +S Sbjct: 874 PLNLSKKSPSPSPRPLVGPCKALS 897 >DQ011227-1|AAY63896.1| 484|Apis mellifera Amt-1-like protein protein. Length = 484 Score = 24.2 bits (50), Expect = 1.4 Identities = 10/23 (43%), Positives = 16/23 (69%) Frame = +3 Query: 663 LEVENVMLKNELNVLNREVADLL 731 LE V LKNE+N++ + V D++ Sbjct: 51 LESGCVSLKNEVNIMMKNVVDIV 73 >DQ000307-1|AAY21180.1| 423|Apis mellifera major royal jelly protein 9 protein. Length = 423 Score = 23.8 bits (49), Expect = 1.9 Identities = 8/16 (50%), Positives = 11/16 (68%) Frame = +3 Query: 759 NKVEKVANGHAEFNSI 806 NK +K+ANG FN + Sbjct: 378 NKYQKIANGDLNFNEV 393 >AB161182-1|BAD08344.1| 1040|Apis mellifera metabotropic glutamate receptor protein. Length = 1040 Score = 22.6 bits (46), Expect = 4.4 Identities = 13/44 (29%), Positives = 19/44 (43%) Frame = -2 Query: 694 SFFNITFSTSKFCILYVHSSSLTISRSTGKLCLLCLKPKWSVLL 563 +F + F T L + S S+TIS S PK ++L Sbjct: 863 AFVPLYFGTGNNVALRITSMSVTISLSASVTIACLFSPKLYIIL 906 >AJ968562-1|CAI91546.1| 998|Apis mellifera protein ( Apis mellifera ORF for hypotheticalprotein. ). Length = 998 Score = 21.8 bits (44), Expect = 7.7 Identities = 8/13 (61%), Positives = 9/13 (69%) Frame = -1 Query: 167 LFFESPNFAQFYT 129 LF PNFA FY+ Sbjct: 790 LFASMPNFADFYS 802 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 215,399 Number of Sequences: 438 Number of extensions: 5060 Number of successful extensions: 12 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 12 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 12 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 25731924 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -