BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0774 (805 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY336529-1|AAQ02340.1| 712|Apis mellifera transferrin protein. 25 0.82 AY336528-1|AAQ02339.1| 712|Apis mellifera transferrin protein. 25 0.82 AY217097-1|AAO39761.1| 712|Apis mellifera transferrin protein. 25 0.82 DQ667184-1|ABG75736.1| 489|Apis mellifera GABA-gated ion channe... 23 4.4 DQ325132-1|ABD14146.1| 189|Apis mellifera complementary sex det... 22 5.8 DQ325131-1|ABD14145.1| 189|Apis mellifera complementary sex det... 22 5.8 DQ325090-1|ABD14104.1| 178|Apis mellifera complementary sex det... 22 5.8 DQ325082-1|ABD14096.1| 179|Apis mellifera complementary sex det... 22 5.8 DQ325081-1|ABD14095.1| 186|Apis mellifera complementary sex det... 22 5.8 DQ325080-1|ABD14094.1| 184|Apis mellifera complementary sex det... 22 5.8 DQ325079-1|ABD14093.1| 184|Apis mellifera complementary sex det... 22 5.8 DQ325078-1|ABD14092.1| 184|Apis mellifera complementary sex det... 22 5.8 DQ325077-1|ABD14091.1| 181|Apis mellifera complementary sex det... 22 5.8 AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor pr... 22 5.8 AY569705-1|AAS86658.1| 419|Apis mellifera complementary sex det... 22 5.8 AY569703-1|AAS86656.1| 396|Apis mellifera complementary sex det... 22 5.8 AY569701-1|AAS86654.1| 407|Apis mellifera complementary sex det... 22 5.8 AY569700-1|AAS86653.1| 407|Apis mellifera complementary sex det... 22 5.8 AY569699-1|AAS86652.1| 396|Apis mellifera complementary sex det... 22 5.8 AY569697-1|AAS86650.1| 413|Apis mellifera complementary sex det... 22 5.8 AY569694-1|AAS86647.1| 400|Apis mellifera complementary sex det... 22 5.8 AY352277-1|AAQ67418.1| 418|Apis mellifera complementary sex det... 22 5.8 DQ325109-1|ABD14123.1| 177|Apis mellifera complementary sex det... 22 7.7 DQ325108-1|ABD14122.1| 177|Apis mellifera complementary sex det... 22 7.7 DQ325107-1|ABD14121.1| 176|Apis mellifera complementary sex det... 22 7.7 DQ325106-1|ABD14120.1| 177|Apis mellifera complementary sex det... 22 7.7 DQ011228-1|AAY63897.1| 486|Apis mellifera Amt-2-like protein pr... 22 7.7 AY350615-1|AAQ57657.1| 410|Apis mellifera complementary sex det... 22 7.7 >AY336529-1|AAQ02340.1| 712|Apis mellifera transferrin protein. Length = 712 Score = 25.0 bits (52), Expect = 0.82 Identities = 8/17 (47%), Positives = 12/17 (70%) Frame = +3 Query: 570 RALKEVRQNLCHMCQQP 620 R LKE N+C +C++P Sbjct: 209 RRLKETYSNMCALCEKP 225 >AY336528-1|AAQ02339.1| 712|Apis mellifera transferrin protein. Length = 712 Score = 25.0 bits (52), Expect = 0.82 Identities = 8/17 (47%), Positives = 12/17 (70%) Frame = +3 Query: 570 RALKEVRQNLCHMCQQP 620 R LKE N+C +C++P Sbjct: 209 RRLKETYSNMCALCEKP 225 >AY217097-1|AAO39761.1| 712|Apis mellifera transferrin protein. Length = 712 Score = 25.0 bits (52), Expect = 0.82 Identities = 8/17 (47%), Positives = 12/17 (70%) Frame = +3 Query: 570 RALKEVRQNLCHMCQQP 620 R LKE N+C +C++P Sbjct: 209 RRLKETYSNMCALCEKP 225 >DQ667184-1|ABG75736.1| 489|Apis mellifera GABA-gated ion channel protein. Length = 489 Score = 22.6 bits (46), Expect = 4.4 Identities = 8/32 (25%), Positives = 15/32 (46%) Frame = -1 Query: 136 CVFSLFLYPRQNQRCVIFALNFYYGT*SRILY 41 C+ L YP +Q C + ++ Y ++Y Sbjct: 161 CMMDLHYYPLDSQNCTVEIESYGYTVLDVVMY 192 >DQ325132-1|ABD14146.1| 189|Apis mellifera complementary sex determiner protein. Length = 189 Score = 22.2 bits (45), Expect = 5.8 Identities = 10/30 (33%), Positives = 17/30 (56%) Frame = +3 Query: 660 EDIEKLKDKMAIRVSNRKTLKRTRQRNWKS 749 E + K+K+ ++RK R+R+R KS Sbjct: 20 EKLHNEKEKLLEERTSRKRYSRSREREQKS 49 >DQ325131-1|ABD14145.1| 189|Apis mellifera complementary sex determiner protein. Length = 189 Score = 22.2 bits (45), Expect = 5.8 Identities = 10/30 (33%), Positives = 17/30 (56%) Frame = +3 Query: 660 EDIEKLKDKMAIRVSNRKTLKRTRQRNWKS 749 E + K+K+ ++RK R+R+R KS Sbjct: 20 EKLHNEKEKLLEERTSRKRYSRSREREQKS 49 >DQ325090-1|ABD14104.1| 178|Apis mellifera complementary sex determiner protein. Length = 178 Score = 22.2 bits (45), Expect = 5.8 Identities = 10/30 (33%), Positives = 17/30 (56%) Frame = +3 Query: 660 EDIEKLKDKMAIRVSNRKTLKRTRQRNWKS 749 E + K+K+ ++RK R+R+R KS Sbjct: 20 EKLHNEKEKLLEERTSRKRYSRSREREQKS 49 >DQ325082-1|ABD14096.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 22.2 bits (45), Expect = 5.8 Identities = 10/30 (33%), Positives = 17/30 (56%) Frame = +3 Query: 660 EDIEKLKDKMAIRVSNRKTLKRTRQRNWKS 749 E + K+K+ ++RK R+R+R KS Sbjct: 20 EKLHNEKEKLLEERTSRKRYSRSREREQKS 49 >DQ325081-1|ABD14095.1| 186|Apis mellifera complementary sex determiner protein. Length = 186 Score = 22.2 bits (45), Expect = 5.8 Identities = 10/30 (33%), Positives = 17/30 (56%) Frame = +3 Query: 660 EDIEKLKDKMAIRVSNRKTLKRTRQRNWKS 749 E + K+K+ ++RK R+R+R KS Sbjct: 20 EKLHNEKEKLLEERTSRKRYSRSREREQKS 49 >DQ325080-1|ABD14094.1| 184|Apis mellifera complementary sex determiner protein. Length = 184 Score = 22.2 bits (45), Expect = 5.8 Identities = 10/30 (33%), Positives = 17/30 (56%) Frame = +3 Query: 660 EDIEKLKDKMAIRVSNRKTLKRTRQRNWKS 749 E + K+K+ ++RK R+R+R KS Sbjct: 20 EKLHNEKEKLLEERTSRKRYSRSREREQKS 49 >DQ325079-1|ABD14093.1| 184|Apis mellifera complementary sex determiner protein. Length = 184 Score = 22.2 bits (45), Expect = 5.8 Identities = 10/30 (33%), Positives = 17/30 (56%) Frame = +3 Query: 660 EDIEKLKDKMAIRVSNRKTLKRTRQRNWKS 749 E + K+K+ ++RK R+R+R KS Sbjct: 20 EKLHNEKEKLLEERTSRKRYSRSREREQKS 49 >DQ325078-1|ABD14092.1| 184|Apis mellifera complementary sex determiner protein. Length = 184 Score = 22.2 bits (45), Expect = 5.8 Identities = 10/30 (33%), Positives = 17/30 (56%) Frame = +3 Query: 660 EDIEKLKDKMAIRVSNRKTLKRTRQRNWKS 749 E + K+K+ ++RK R+R+R KS Sbjct: 20 EKLHNEKEKLLEERTSRKRYSRSREREQKS 49 >DQ325077-1|ABD14091.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 22.2 bits (45), Expect = 5.8 Identities = 10/30 (33%), Positives = 17/30 (56%) Frame = +3 Query: 660 EDIEKLKDKMAIRVSNRKTLKRTRQRNWKS 749 E + K+K+ ++RK R+R+R KS Sbjct: 20 EKLHNEKEKLLEERTSRKRYSRSREREQKS 49 >AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor protein. Length = 1370 Score = 22.2 bits (45), Expect = 5.8 Identities = 9/20 (45%), Positives = 11/20 (55%) Frame = -2 Query: 213 LASFSFERAHRVEELYRHHN 154 L F FER + ELY +N Sbjct: 857 LKGFEFERLSHLRELYLQNN 876 >AY569705-1|AAS86658.1| 419|Apis mellifera complementary sex determiner protein. Length = 419 Score = 22.2 bits (45), Expect = 5.8 Identities = 10/30 (33%), Positives = 17/30 (56%) Frame = +3 Query: 660 EDIEKLKDKMAIRVSNRKTLKRTRQRNWKS 749 E + K+K+ ++RK R+R+R KS Sbjct: 253 EKLHNEKEKLLEERTSRKRYSRSREREQKS 282 >AY569703-1|AAS86656.1| 396|Apis mellifera complementary sex determiner protein. Length = 396 Score = 22.2 bits (45), Expect = 5.8 Identities = 10/30 (33%), Positives = 17/30 (56%) Frame = +3 Query: 660 EDIEKLKDKMAIRVSNRKTLKRTRQRNWKS 749 E + K+K+ ++RK R+R+R KS Sbjct: 242 EKLHNEKEKLLEERTSRKRYSRSREREQKS 271 >AY569701-1|AAS86654.1| 407|Apis mellifera complementary sex determiner protein. Length = 407 Score = 22.2 bits (45), Expect = 5.8 Identities = 10/30 (33%), Positives = 17/30 (56%) Frame = +3 Query: 660 EDIEKLKDKMAIRVSNRKTLKRTRQRNWKS 749 E + K+K+ ++RK R+R+R KS Sbjct: 253 EKLHNEKEKLLEERTSRKRYSRSREREQKS 282 >AY569700-1|AAS86653.1| 407|Apis mellifera complementary sex determiner protein. Length = 407 Score = 22.2 bits (45), Expect = 5.8 Identities = 10/30 (33%), Positives = 17/30 (56%) Frame = +3 Query: 660 EDIEKLKDKMAIRVSNRKTLKRTRQRNWKS 749 E + K+K+ ++RK R+R+R KS Sbjct: 253 EKLHNEKEKLLEERTSRKRYSRSREREQKS 282 >AY569699-1|AAS86652.1| 396|Apis mellifera complementary sex determiner protein. Length = 396 Score = 22.2 bits (45), Expect = 5.8 Identities = 10/30 (33%), Positives = 17/30 (56%) Frame = +3 Query: 660 EDIEKLKDKMAIRVSNRKTLKRTRQRNWKS 749 E + K+K+ ++RK R+R+R KS Sbjct: 242 EKLHNEKEKLLEERTSRKRYSRSREREQKS 271 >AY569697-1|AAS86650.1| 413|Apis mellifera complementary sex determiner protein. Length = 413 Score = 22.2 bits (45), Expect = 5.8 Identities = 10/30 (33%), Positives = 17/30 (56%) Frame = +3 Query: 660 EDIEKLKDKMAIRVSNRKTLKRTRQRNWKS 749 E + K+K+ ++RK R+R+R KS Sbjct: 253 EKLHNEKEKLLEERTSRKRYSRSREREQKS 282 >AY569694-1|AAS86647.1| 400|Apis mellifera complementary sex determiner protein. Length = 400 Score = 22.2 bits (45), Expect = 5.8 Identities = 10/30 (33%), Positives = 17/30 (56%) Frame = +3 Query: 660 EDIEKLKDKMAIRVSNRKTLKRTRQRNWKS 749 E + K+K+ ++RK R+R+R KS Sbjct: 242 EKLHNEKEKLLEERTSRKRYSRSREREQKS 271 >AY352277-1|AAQ67418.1| 418|Apis mellifera complementary sex determiner protein. Length = 418 Score = 22.2 bits (45), Expect = 5.8 Identities = 10/30 (33%), Positives = 17/30 (56%) Frame = +3 Query: 660 EDIEKLKDKMAIRVSNRKTLKRTRQRNWKS 749 E + K+K+ ++RK R+R+R KS Sbjct: 258 EKLHNEKEKLLEERTSRKRYSRSREREQKS 287 >DQ325109-1|ABD14123.1| 177|Apis mellifera complementary sex determiner protein. Length = 177 Score = 21.8 bits (44), Expect = 7.7 Identities = 10/30 (33%), Positives = 17/30 (56%) Frame = +3 Query: 660 EDIEKLKDKMAIRVSNRKTLKRTRQRNWKS 749 E + K+K+ ++RK R+R+R KS Sbjct: 20 EKLHNEKEKLLEERTSRKRYSRSREREKKS 49 >DQ325108-1|ABD14122.1| 177|Apis mellifera complementary sex determiner protein. Length = 177 Score = 21.8 bits (44), Expect = 7.7 Identities = 10/30 (33%), Positives = 17/30 (56%) Frame = +3 Query: 660 EDIEKLKDKMAIRVSNRKTLKRTRQRNWKS 749 E + K+K+ ++RK R+R+R KS Sbjct: 20 EKLHNEKEKLLEERTSRKRYSRSREREKKS 49 >DQ325107-1|ABD14121.1| 176|Apis mellifera complementary sex determiner protein. Length = 176 Score = 21.8 bits (44), Expect = 7.7 Identities = 10/30 (33%), Positives = 17/30 (56%) Frame = +3 Query: 660 EDIEKLKDKMAIRVSNRKTLKRTRQRNWKS 749 E + K+K+ ++RK R+R+R KS Sbjct: 20 EKLHNEKEKLLEERTSRKRYSRSREREKKS 49 >DQ325106-1|ABD14120.1| 177|Apis mellifera complementary sex determiner protein. Length = 177 Score = 21.8 bits (44), Expect = 7.7 Identities = 10/30 (33%), Positives = 17/30 (56%) Frame = +3 Query: 660 EDIEKLKDKMAIRVSNRKTLKRTRQRNWKS 749 E + K+K+ ++RK R+R+R KS Sbjct: 20 EKLHNEKEKLLEERTSRKRYSRSREREKKS 49 >DQ011228-1|AAY63897.1| 486|Apis mellifera Amt-2-like protein protein. Length = 486 Score = 21.8 bits (44), Expect = 7.7 Identities = 10/20 (50%), Positives = 14/20 (70%), Gaps = 1/20 (5%) Frame = -2 Query: 141 KYVFF-HYFFIQDKTNVVLF 85 KY+ F +FFI+ TNV+ F Sbjct: 8 KYINFDRFFFIEGMTNVLDF 27 >AY350615-1|AAQ57657.1| 410|Apis mellifera complementary sex determiner protein. Length = 410 Score = 21.8 bits (44), Expect = 7.7 Identities = 10/30 (33%), Positives = 17/30 (56%) Frame = +3 Query: 660 EDIEKLKDKMAIRVSNRKTLKRTRQRNWKS 749 E + K+K+ ++RK R+R+R KS Sbjct: 253 EKLHNEKEKLLEERTSRKRYSRSREREKKS 282 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 222,764 Number of Sequences: 438 Number of extensions: 4640 Number of successful extensions: 48 Number of sequences better than 10.0: 28 Number of HSP's better than 10.0 without gapping: 48 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 48 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 25489170 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -