BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0772 (753 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF024494-9|AAB70333.1| 336|Caenorhabditis elegans Serpentine re... 30 2.0 AC024771-2|AAK70659.1| 697|Caenorhabditis elegans Hypothetical ... 30 2.0 Z81564-3|CAB04577.1| 536|Caenorhabditis elegans Hypothetical pr... 29 2.7 AL021386-2|CAA16165.1| 240|Caenorhabditis elegans Hypothetical ... 29 3.5 L40996-1|AAA86431.1| 593|Caenorhabditis elegans GTP-binding pro... 29 4.7 AF125969-2|AAD14761.1| 613|Caenorhabditis elegans Caenorhabditi... 29 4.7 Z77136-1|CAB00880.1| 606|Caenorhabditis elegans Hypothetical pr... 28 8.2 U61951-3|AAB03158.4| 1783|Caenorhabditis elegans Egg laying defe... 28 8.2 U61951-2|AAM75372.1| 1877|Caenorhabditis elegans Egg laying defe... 28 8.2 U00055-4|AAA50720.2| 431|Caenorhabditis elegans Hypothetical pr... 28 8.2 AF023602-1|AAC47755.1| 1783|Caenorhabditis elegans putative L-ty... 28 8.2 >AF024494-9|AAB70333.1| 336|Caenorhabditis elegans Serpentine receptor, class u protein27 protein. Length = 336 Score = 29.9 bits (64), Expect = 2.0 Identities = 19/55 (34%), Positives = 28/55 (50%), Gaps = 2/55 (3%) Frame = -1 Query: 627 IFSSHISLIHCVIVERPF*QEKIFTTILCAGMPF--VYPFKSGFFDHFIHPGTPF 469 IF +S + V++ P QEKI IL + +PF +YP FF F+ P + Sbjct: 128 IFPFLVSTMRLVLIAYPQRQEKINRVILKSALPFILIYPM---FFTFFMWPAVGY 179 >AC024771-2|AAK70659.1| 697|Caenorhabditis elegans Hypothetical protein Y40B10A.4 protein. Length = 697 Score = 29.9 bits (64), Expect = 2.0 Identities = 15/34 (44%), Positives = 22/34 (64%) Frame = +2 Query: 230 QDYEVTKTDLKLIVKHIPKLSKQPKHLVVLSDSD 331 Q E+ K DLKLI++H + +Q KH +V D+D Sbjct: 85 QCLELVKEDLKLIMEHHNVVIEQFKHEIVDDDND 118 >Z81564-3|CAB04577.1| 536|Caenorhabditis elegans Hypothetical protein K05C4.3 protein. Length = 536 Score = 29.5 bits (63), Expect = 2.7 Identities = 21/56 (37%), Positives = 34/56 (60%), Gaps = 5/56 (8%) Frame = -2 Query: 515 SNQVSLTILYTPEHLSCS-SQLH*KVFLL---DMKVDLIHHKNLK-TVFRLLNSIS 363 SNQ+ T+L LSC + + VF L D+K++LIHH+++K T L+S++ Sbjct: 36 SNQIFATLLNNRFLLSCELNDIKGLVFNLTDVDLKMNLIHHESMKMTKSHCLDSLA 91 >AL021386-2|CAA16165.1| 240|Caenorhabditis elegans Hypothetical protein F57E7.2 protein. Length = 240 Score = 29.1 bits (62), Expect = 3.5 Identities = 14/55 (25%), Positives = 27/55 (49%) Frame = +2 Query: 206 YWLKKHSLQDYEVTKTDLKLIVKHIPKLSKQPKHLVVLSDSDYHSIDDLARMVIW 370 +W + ++ DY V K D ++ + K S KHL+ +S ++ +A + W Sbjct: 43 FWYNRSAMSDYSVPKLDSEVQYLIVVKNSSLTKHLIRKLESYNWTLPAIATLDKW 97 >L40996-1|AAA86431.1| 593|Caenorhabditis elegans GTP-binding protein protein. Length = 593 Score = 28.7 bits (61), Expect = 4.7 Identities = 16/43 (37%), Positives = 25/43 (58%), Gaps = 4/43 (9%) Frame = -2 Query: 485 TPEHLSCSSQLH*KVFLLDMKVDL----IHHKNLKTVFRLLNS 369 T EHLS + LH V+L+ K+D+ I + +K + RL+ S Sbjct: 270 TKEHLSLALSLHVPVYLVVTKIDMCPAYILEETMKNITRLVRS 312 >AF125969-2|AAD14761.1| 613|Caenorhabditis elegans Caenorhabditis gtp-binding proteinprotein 1 protein. Length = 613 Score = 28.7 bits (61), Expect = 4.7 Identities = 16/43 (37%), Positives = 25/43 (58%), Gaps = 4/43 (9%) Frame = -2 Query: 485 TPEHLSCSSQLH*KVFLLDMKVDL----IHHKNLKTVFRLLNS 369 T EHLS + LH V+L+ K+D+ I + +K + RL+ S Sbjct: 269 TKEHLSLALSLHVPVYLVVTKIDMCPANILEETMKNITRLVRS 311 >Z77136-1|CAB00880.1| 606|Caenorhabditis elegans Hypothetical protein ZC376.1 protein. Length = 606 Score = 27.9 bits (59), Expect = 8.2 Identities = 17/67 (25%), Positives = 33/67 (49%), Gaps = 3/67 (4%) Frame = +2 Query: 383 GIPFLSFYDVSGQLSYQEEKLFNAVE---KNKKGVPGCIKWSKKPDLNGYTNGIPAHKIV 553 GIP++ G+L +++ +L + E + K P C+ + +K NG+ I + Sbjct: 49 GIPYVE--PPIGELRFRKPRLLKSWEGVLETKDYKPACMSYWRKTFKNGFVGEISEDCLY 106 Query: 554 VNIFSCQ 574 N+F+ Q Sbjct: 107 ANVFTNQ 113 >U61951-3|AAB03158.4| 1783|Caenorhabditis elegans Egg laying defective protein 19,isoform a protein. Length = 1783 Score = 27.9 bits (59), Expect = 8.2 Identities = 14/37 (37%), Positives = 20/37 (54%) Frame = -3 Query: 700 GRVYC*YHIIKFLCGNLVTFSIIWNFFLTHFFDTLCN 590 G + C Y+I+ F+CGN I+ N FL D L + Sbjct: 676 GVIVCIYYIVLFICGNY----ILLNVFLAIAVDNLAD 708 >U61951-2|AAM75372.1| 1877|Caenorhabditis elegans Egg laying defective protein 19,isoform b protein. Length = 1877 Score = 27.9 bits (59), Expect = 8.2 Identities = 14/37 (37%), Positives = 20/37 (54%) Frame = -3 Query: 700 GRVYC*YHIIKFLCGNLVTFSIIWNFFLTHFFDTLCN 590 G + C Y+I+ F+CGN I+ N FL D L + Sbjct: 676 GVIVCIYYIVLFICGNY----ILLNVFLAIAVDNLAD 708 >U00055-4|AAA50720.2| 431|Caenorhabditis elegans Hypothetical protein R02F2.4 protein. Length = 431 Score = 27.9 bits (59), Expect = 8.2 Identities = 11/25 (44%), Positives = 14/25 (56%) Frame = +2 Query: 527 NGIPAHKIVVNIFSCQNGRSTITQC 601 NG+ A + SCQNGR I +C Sbjct: 315 NGLYALDCTPRVLSCQNGRENIFEC 339 >AF023602-1|AAC47755.1| 1783|Caenorhabditis elegans putative L-type calcium channelalpha 1 subunit protein. Length = 1783 Score = 27.9 bits (59), Expect = 8.2 Identities = 14/37 (37%), Positives = 20/37 (54%) Frame = -3 Query: 700 GRVYC*YHIIKFLCGNLVTFSIIWNFFLTHFFDTLCN 590 G + C Y+I+ F+CGN I+ N FL D L + Sbjct: 676 GVIVCIYYIVLFICGNY----ILLNVFLAIAVDNLAD 708 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,552,007 Number of Sequences: 27780 Number of extensions: 352117 Number of successful extensions: 1087 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 1035 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1087 length of database: 12,740,198 effective HSP length: 80 effective length of database: 10,517,798 effective search space used: 1788025660 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -