BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0628 (759 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY187042-1|AAO39756.1| 248|Anopheles gambiae putative antennal ... 33 0.007 AJ439060-17|CAD27768.1| 568|Anopheles gambiae putative chitin b... 29 0.16 AY187041-1|AAO39755.1| 272|Anopheles gambiae putative antennal ... 27 0.83 AY579078-1|AAT81602.1| 425|Anopheles gambiae neuropeptide F rec... 23 7.7 >AY187042-1|AAO39756.1| 248|Anopheles gambiae putative antennal carrier protein TOL-2 protein. Length = 248 Score = 33.5 bits (73), Expect = 0.007 Identities = 14/47 (29%), Positives = 24/47 (51%) Frame = +3 Query: 591 GNTVLQFLNENWRVVTEEFGQPVVDYALNVTVNTAKKFFDAVPYDEL 731 G+ + QFLN+NW + +E ++ + F+ VPY+EL Sbjct: 197 GDNMNQFLNDNWEDILKELKPAIIGAFTKIFRAIITNVFENVPYEEL 243 >AJ439060-17|CAD27768.1| 568|Anopheles gambiae putative chitin binding protein protein. Length = 568 Score = 29.1 bits (62), Expect = 0.16 Identities = 14/24 (58%), Positives = 15/24 (62%) Frame = -3 Query: 526 RVLSGRQRLGSVPGIAEVHGRR*P 455 R +GR R G VPG AE H RR P Sbjct: 315 REAAGRLRTGPVPGAAERHRRRRP 338 >AY187041-1|AAO39755.1| 272|Anopheles gambiae putative antennal carrier protein TOL-1 protein. Length = 272 Score = 26.6 bits (56), Expect = 0.83 Identities = 11/40 (27%), Positives = 20/40 (50%) Frame = +3 Query: 606 QFLNENWRVVTEEFGQPVVDYALNVTVNTAKKFFDAVPYD 725 Q+LN+NWR V+E + ++ + + F +P D Sbjct: 221 QYLNDNWRPVSEALKPIIAKTIEDILLAIMQNIFHQLPAD 260 >AY579078-1|AAT81602.1| 425|Anopheles gambiae neuropeptide F receptor protein. Length = 425 Score = 23.4 bits (48), Expect = 7.7 Identities = 9/24 (37%), Positives = 13/24 (54%) Frame = +3 Query: 210 CI*GWKLAWFLFTYSMWILCYSYL 281 CI W +A+ YS + LC Y+ Sbjct: 200 CIEDWPIAYGRVYYSAFTLCVQYV 223 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 749,381 Number of Sequences: 2352 Number of extensions: 16326 Number of successful extensions: 16 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 16 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 16 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 78586767 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -