BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0622 (690 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY043293-2|AAK96034.1| 353|Tribolium castaneum homeodomain tran... 25 0.44 AF231104-1|AAF64149.1| 142|Tribolium castaneum labial protein p... 25 0.44 AF231103-1|AAF64148.1| 142|Tribolium castaneum labial protein p... 25 0.44 EF125543-1|ABL73927.1| 475|Tribolium castaneum chitinase 4 prot... 25 0.77 DQ659247-1|ABG47445.1| 980|Tribolium castaneum chitinase 7 prot... 22 4.1 EF125544-1|ABL73928.1| 279|Tribolium castaneum obstractor B pro... 22 5.4 >AY043293-2|AAK96034.1| 353|Tribolium castaneum homeodomain transcription factor Labialprotein. Length = 353 Score = 25.4 bits (53), Expect = 0.44 Identities = 14/34 (41%), Positives = 18/34 (52%) Frame = +2 Query: 164 RSSALIKRTTSLQ*INCAETALRNEQALQITEDE 265 RSS L T+S+ +NC T N Q+TE E Sbjct: 236 RSSCLGSNTSSMLSLNCLNTGRTNFTNKQLTELE 269 >AF231104-1|AAF64149.1| 142|Tribolium castaneum labial protein protein. Length = 142 Score = 25.4 bits (53), Expect = 0.44 Identities = 14/34 (41%), Positives = 18/34 (52%) Frame = +2 Query: 164 RSSALIKRTTSLQ*INCAETALRNEQALQITEDE 265 RSS L T+S+ +NC T N Q+TE E Sbjct: 25 RSSCLGSNTSSMLSLNCLNTGRTNFTNKQLTELE 58 >AF231103-1|AAF64148.1| 142|Tribolium castaneum labial protein protein. Length = 142 Score = 25.4 bits (53), Expect = 0.44 Identities = 14/34 (41%), Positives = 18/34 (52%) Frame = +2 Query: 164 RSSALIKRTTSLQ*INCAETALRNEQALQITEDE 265 RSS L T+S+ +NC T N Q+TE E Sbjct: 25 RSSCLGSNTSSMLSLNCLNTGRTNFTNKQLTELE 58 >EF125543-1|ABL73927.1| 475|Tribolium castaneum chitinase 4 protein. Length = 475 Score = 24.6 bits (51), Expect = 0.77 Identities = 13/34 (38%), Positives = 18/34 (52%), Gaps = 1/34 (2%) Frame = +1 Query: 463 SPEAKDRTITLAEVAHH-DTPDDCWIVIYDRVYD 561 +P ++D T TL A + PDDC I Y Y+ Sbjct: 411 APPSRDLTTTLCTKAGYVRDPDDCSIFYYCLAYN 444 >DQ659247-1|ABG47445.1| 980|Tribolium castaneum chitinase 7 protein. Length = 980 Score = 22.2 bits (45), Expect = 4.1 Identities = 10/27 (37%), Positives = 13/27 (48%) Frame = +2 Query: 455 YQAHLKPRTAQLLWQKLPTMTPPMIVG 535 YQ L A LW KL T +++G Sbjct: 304 YQKQLNVEHAANLWVKLGTPKEKLVIG 330 >EF125544-1|ABL73928.1| 279|Tribolium castaneum obstractor B protein. Length = 279 Score = 21.8 bits (44), Expect = 5.4 Identities = 7/18 (38%), Positives = 13/18 (72%) Frame = -2 Query: 659 ECPELLKAVLASRPAYSN 606 ECP++ + V A+ P Y++ Sbjct: 171 ECPKVNETVAATHPRYAD 188 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 163,239 Number of Sequences: 336 Number of extensions: 3389 Number of successful extensions: 9 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 18114270 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -