BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0622 (690 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB270697-1|BAF75928.1| 735|Apis mellifera FoxP protein protein. 23 2.1 AJ276511-1|CAC06383.1| 352|Apis mellifera Antennapedia protein ... 23 3.6 D79208-1|BAA11466.1| 567|Apis mellifera alpha-glucosidase protein. 22 6.3 AB253417-1|BAE86928.1| 567|Apis mellifera alpha-glucosidase pro... 22 6.3 DQ257416-1|ABB81847.1| 552|Apis mellifera yellow-h protein. 21 8.4 >AB270697-1|BAF75928.1| 735|Apis mellifera FoxP protein protein. Length = 735 Score = 23.4 bits (48), Expect = 2.1 Identities = 11/31 (35%), Positives = 17/31 (54%) Frame = +2 Query: 38 ALMHHLNIAKNKLKYEQLWHSDNWCDSHSPR 130 A+MHHL++AK E S++ S P+ Sbjct: 339 AMMHHLHVAKQMASPEPPKSSESSTGSSIPK 369 >AJ276511-1|CAC06383.1| 352|Apis mellifera Antennapedia protein protein. Length = 352 Score = 22.6 bits (46), Expect = 3.6 Identities = 8/18 (44%), Positives = 12/18 (66%) Frame = -3 Query: 637 PCLRLGLRTPTLYRHRQD 584 P R+ +R T Y+H+QD Sbjct: 82 PYNRMDMRNATYYQHQQD 99 >D79208-1|BAA11466.1| 567|Apis mellifera alpha-glucosidase protein. Length = 567 Score = 21.8 bits (44), Expect = 6.3 Identities = 9/16 (56%), Positives = 10/16 (62%) Frame = +1 Query: 556 YDISTFLDEHPGGGDI 603 YDIS + D HP G I Sbjct: 84 YDISNYTDVHPIFGTI 99 >AB253417-1|BAE86928.1| 567|Apis mellifera alpha-glucosidase protein. Length = 567 Score = 21.8 bits (44), Expect = 6.3 Identities = 9/16 (56%), Positives = 10/16 (62%) Frame = +1 Query: 556 YDISTFLDEHPGGGDI 603 YDIS + D HP G I Sbjct: 84 YDISNYTDVHPIFGTI 99 >DQ257416-1|ABB81847.1| 552|Apis mellifera yellow-h protein. Length = 552 Score = 21.4 bits (43), Expect = 8.4 Identities = 8/18 (44%), Positives = 11/18 (61%) Frame = +2 Query: 605 CWSTQAETQARLSGVLGT 658 CW T+ E + GV+GT Sbjct: 459 CWDTRKEYIPQNLGVIGT 476 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 195,362 Number of Sequences: 438 Number of extensions: 4334 Number of successful extensions: 9 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 21073995 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -