BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0621 (740 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292374-1|CAL23186.2| 659|Tribolium castaneum gustatory recept... 24 1.1 AM292340-1|CAL23152.1| 355|Tribolium castaneum gustatory recept... 21 7.9 >AM292374-1|CAL23186.2| 659|Tribolium castaneum gustatory receptor candidate 53 protein. Length = 659 Score = 24.2 bits (50), Expect = 1.1 Identities = 13/52 (25%), Positives = 21/52 (40%) Frame = +1 Query: 307 VFLILLFSCQAKYVLYLPVCKILLFCSSCHFVI*TW*TNAAFKTKTKHSLNK 462 ++ I + K + + IL F++ W T A +K H LNK Sbjct: 58 IYHIFMHIVPTKLISFYKSTAILEIAFEVIFIVTVWMTGAVKHSKIAHFLNK 109 >AM292340-1|CAL23152.1| 355|Tribolium castaneum gustatory receptor candidate 19 protein. Length = 355 Score = 21.4 bits (43), Expect = 7.9 Identities = 12/48 (25%), Positives = 21/48 (43%) Frame = +2 Query: 263 NYKLRSLKCSLVFPWCS*YFCSLVKQNMYFIYQCVRFYYFVVHVIS*Y 406 N L L CS F ++C + ++F+ FYY + ++ Y Sbjct: 67 NVHLLFLLCSGYFTVHLLFYCPFIIFTVHFLLCTYYFYYAFIILLCVY 114 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 162,814 Number of Sequences: 336 Number of extensions: 3328 Number of successful extensions: 5 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 19884055 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -