BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0621 (740 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AF274024-1|AAF90150.1| 232|Apis mellifera tetraspanin F139 prot... 23 3.0 DQ015969-1|AAY81926.1| 397|Apis mellifera stargazin related pro... 22 5.3 EF591128-1|ABQ59246.1| 684|Apis mellifera hexamerin 70a protein. 21 9.2 AM050259-1|CAJ18340.1| 683|Apis mellifera putative H3K9 methylt... 21 9.2 AB167961-1|BAD51404.1| 554|Apis mellifera E74 protein. 21 9.2 >AF274024-1|AAF90150.1| 232|Apis mellifera tetraspanin F139 protein. Length = 232 Score = 23.0 bits (47), Expect = 3.0 Identities = 9/32 (28%), Positives = 21/32 (65%) Frame = -2 Query: 469 FASYLMNVLFLF*MLHLFTKFILRNDMNYKII 374 FAS+L+ +L + + ++ +++ND N++ I Sbjct: 84 FASFLLFILLVQIAVAVYAFIVVKNDDNFRNI 115 >DQ015969-1|AAY81926.1| 397|Apis mellifera stargazin related protein STG-1 protein. Length = 397 Score = 22.2 bits (45), Expect = 5.3 Identities = 6/16 (37%), Positives = 12/16 (75%) Frame = -2 Query: 628 LFNIINFYLHHVNSHA 581 ++++ N ++HH N HA Sbjct: 273 VYHLDNHHVHHANHHA 288 >EF591128-1|ABQ59246.1| 684|Apis mellifera hexamerin 70a protein. Length = 684 Score = 21.4 bits (43), Expect = 9.2 Identities = 6/10 (60%), Positives = 10/10 (100%) Frame = -2 Query: 88 NKLLFFVEDV 59 NKL++F+ED+ Sbjct: 218 NKLIYFIEDI 227 >AM050259-1|CAJ18340.1| 683|Apis mellifera putative H3K9 methyltransferase protein. Length = 683 Score = 21.4 bits (43), Expect = 9.2 Identities = 8/14 (57%), Positives = 10/14 (71%) Frame = +2 Query: 629 GNLMHFINLSLNSN 670 GN+ HFIN S + N Sbjct: 572 GNISHFINHSCDPN 585 >AB167961-1|BAD51404.1| 554|Apis mellifera E74 protein. Length = 554 Score = 21.4 bits (43), Expect = 9.2 Identities = 11/33 (33%), Positives = 16/33 (48%) Frame = -3 Query: 672 PFELSDKFIKCIKFPYLILSTFTYTT*IATPPC 574 PF+ D F++ ++ S T TT TP C Sbjct: 69 PFDTLDTFLRELQADLAEASQPTSTTTSVTPSC 101 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 186,720 Number of Sequences: 438 Number of extensions: 3709 Number of successful extensions: 8 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 23144850 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -