BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0620 (636 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_7724| Best HMM Match : ATP-synt_ab_C (HMM E-Value=0) 241 4e-64 SB_55653| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_12284| Best HMM Match : ATP-synt_ab (HMM E-Value=0) 46 3e-05 SB_40036| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.45 SB_44024| Best HMM Match : Flavin_Reduct (HMM E-Value=0.79) 30 1.8 SB_8215| Best HMM Match : FeoB_N (HMM E-Value=4) 30 1.8 SB_53344| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.2 SB_39227| Best HMM Match : DRMBL (HMM E-Value=0.76) 29 4.2 SB_12626| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.2 SB_52368| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.5 SB_24994| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.3 SB_59600| Best HMM Match : DNA_pol_B_2 (HMM E-Value=1.5e-05) 27 9.7 SB_37000| Best HMM Match : Astacin (HMM E-Value=5.5e-19) 27 9.7 >SB_7724| Best HMM Match : ATP-synt_ab_C (HMM E-Value=0) Length = 448 Score = 241 bits (589), Expect = 4e-64 Identities = 113/134 (84%), Positives = 125/134 (93%) Frame = +3 Query: 234 DVQFEDNLPPILNALEVQNRSPRLVLEVAQHLGENTVRTIAMDGTEGLVRGQPVLDSGSP 413 DVQF+++LPPILNALEV+NR+PRL+LEVAQHLGENTVRTIAMDGTEGL+RGQ +D+G P Sbjct: 85 DVQFDEDLPPILNALEVENRTPRLILEVAQHLGENTVRTIAMDGTEGLIRGQKCVDTGGP 144 Query: 414 IRIPVGAETLGRIINVIGEPIDERGPIPTDKTAAIHAEAPEFVDMSVQQEILVTGIKVVD 593 I IPVG ETLGRIINVIGEPIDERGP+ TDK AAIHAEAPEFV+MS +QEIL TGIKVVD Sbjct: 145 ITIPVGPETLGRIINVIGEPIDERGPVETDKRAAIHAEAPEFVEMSTEQEILETGIKVVD 204 Query: 594 LLAPYAKGGKIGLF 635 LLAPYAKGGKIGLF Sbjct: 205 LLAPYAKGGKIGLF 218 >SB_55653| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 390 Score = 62.9 bits (146), Expect = 2e-10 Identities = 31/90 (34%), Positives = 54/90 (60%), Gaps = 1/90 (1%) Frame = +3 Query: 351 IAMDGTEGLVR-GQPVLDSGSPIRIPVGAETLGRIINVIGEPIDERGPIPTDKTAAIHAE 527 + + G + L++ G V +G+ + +PVG E LGR+++ +G PID +GP + A + + Sbjct: 12 VVVFGNDRLIKEGDIVKRTGAIVDVPVGEELLGRVVDALGNPIDGKGPTGGTR-ARVGVK 70 Query: 528 APEFVDMSVQQEILVTGIKVVDLLAPYAKG 617 AP + + +E ++TGIK VD L P +G Sbjct: 71 APGIIPRTSVKEPMLTGIKAVDSLVPIGRG 100 >SB_12284| Best HMM Match : ATP-synt_ab (HMM E-Value=0) Length = 238 Score = 46.0 bits (104), Expect = 3e-05 Identities = 19/24 (79%), Positives = 22/24 (91%) Frame = +3 Query: 564 ILVTGIKVVDLLAPYAKGGKIGLF 635 +L TGIKV+DL+ PYAKGGKIGLF Sbjct: 2 VLFTGIKVIDLIEPYAKGGKIGLF 25 >SB_40036| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 232 Score = 31.9 bits (69), Expect = 0.45 Identities = 20/58 (34%), Positives = 31/58 (53%), Gaps = 1/58 (1%) Frame = -2 Query: 344 NCVLTQMLGYLKYEAGRSILHLKGI*NRRQVIFEL-HIYHSTDNGNNLTLAFSCRFSS 174 NC+L + GYLK ++ I++ G QV++ L +Y S + GNNL F +S Sbjct: 48 NCLLWTIYGYLKDDSTIIIVNFVGA--LLQVVYILCFLYFSRERGNNLAFLFYSAIAS 103 >SB_44024| Best HMM Match : Flavin_Reduct (HMM E-Value=0.79) Length = 308 Score = 29.9 bits (64), Expect = 1.8 Identities = 15/28 (53%), Positives = 18/28 (64%), Gaps = 1/28 (3%) Frame = -3 Query: 469 SPITLMMRPRV-SAPTGIRIGEPESSTG 389 S +T +P SAPTGI G+P SSTG Sbjct: 112 STLTAFGQPSTTSAPTGISFGQPTSSTG 139 >SB_8215| Best HMM Match : FeoB_N (HMM E-Value=4) Length = 231 Score = 29.9 bits (64), Expect = 1.8 Identities = 19/59 (32%), Positives = 28/59 (47%), Gaps = 3/59 (5%) Frame = -2 Query: 593 IDDFYTSYENLLLHRHVDKLWSFSMNSSSLVGGDGTTL-VNRFAD--YIDDATEGFSSH 426 +DD Y Y + L+ +VD L+ V G L V+ + D Y+D +GF SH Sbjct: 168 VDDLYNGYVDDLIDGYVDDLYVDGYVDDLYVDGYVDDLYVDGYVDDLYVDGYVDGFQSH 226 >SB_53344| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1554 Score = 28.7 bits (61), Expect = 4.2 Identities = 23/69 (33%), Positives = 29/69 (42%) Frame = -3 Query: 535 SGASA*IAAVLSVGMGPRSSIGSPITLMMRPRVSAPTGIRIGEPESSTGCPRTKPSVPSM 356 SG+S+ A +L GP SS+ P T P PTG+ + P S P P P M Sbjct: 671 SGSSS--AQMLPPMPGPPSSMSGPTTSRHGP---PPTGLTMNPPTSMGMAPMMPPPGPGM 725 Query: 355 AMVRTVFSP 329 SP Sbjct: 726 GTHPQQVSP 734 >SB_39227| Best HMM Match : DRMBL (HMM E-Value=0.76) Length = 600 Score = 28.7 bits (61), Expect = 4.2 Identities = 26/110 (23%), Positives = 43/110 (39%), Gaps = 4/110 (3%) Frame = +3 Query: 309 LEVAQHL--GENTVRTIAMDGTEGLVRGQPVLDSGSPIRIP-VGAETLGRIINV-IGEPI 476 L V +H G N+ +T ++ T+ RG V PI++P V A + + G Sbjct: 466 LPVVEHFLGGRNSCKTSSVQLTDSKPRGSSVAIINQPIKVPDVNAPGIAIVCQTSSGHQT 525 Query: 477 DERGPIPTDKTAAIHAEAPEFVDMSVQQEILVTGIKVVDLLAPYAKGGKI 626 D + P +H + + E+ G D+LA A G + Sbjct: 526 DSK---PRGDDVLLHRQGDHLAGLVSAGEVRSPGCSPEDVLAVPASPGLV 572 >SB_12626| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 363 Score = 28.7 bits (61), Expect = 4.2 Identities = 16/32 (50%), Positives = 18/32 (56%) Frame = +3 Query: 405 GSPIRIPVGAETLGRIINVIGEPIDERGPIPT 500 G PI P+G +GR I IG PI GPI T Sbjct: 283 GRPIGRPIGL--IGRPIGPIGRPIGPIGPIGT 312 >SB_52368| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 28.3 bits (60), Expect = 5.5 Identities = 20/56 (35%), Positives = 25/56 (44%) Frame = -2 Query: 635 KQPNLSSFGIRSEQIDDFYTSYENLLLHRHVDKLWSFSMNSSSLVGGDGTTLVNRF 468 +QP L G D + YE+LL RH DKL + N S + GD RF Sbjct: 50 QQPMLLEIGAPINIFGDIHGQYEDLL--RHFDKL-GYPPNESYIFLGDYVDRPKRF 102 >SB_24994| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1122 Score = 27.9 bits (59), Expect = 7.3 Identities = 14/38 (36%), Positives = 21/38 (55%), Gaps = 2/38 (5%) Frame = +3 Query: 384 GQPVLDSGSPIRIPVGAETL--GRIINVIGEPIDERGP 491 GQP D+G P G + G+++N GEP++ GP Sbjct: 94 GQPANDTGQPSS-NAGQPLINTGQLVNNTGEPVNNTGP 130 >SB_59600| Best HMM Match : DNA_pol_B_2 (HMM E-Value=1.5e-05) Length = 1119 Score = 27.5 bits (58), Expect = 9.7 Identities = 12/40 (30%), Positives = 23/40 (57%) Frame = +3 Query: 429 GAETLGRIINVIGEPIDERGPIPTDKTAAIHAEAPEFVDM 548 G + L R++ V+ +PI+E +P D A++P+F + Sbjct: 15 GDDWLRRLLEVLPDPIEEDNYLPPDFFYDSLADSPQFASL 54 >SB_37000| Best HMM Match : Astacin (HMM E-Value=5.5e-19) Length = 1341 Score = 27.5 bits (58), Expect = 9.7 Identities = 12/23 (52%), Positives = 14/23 (60%) Frame = -2 Query: 260 RQVIFELHIYHSTDNGNNLTLAF 192 RQ H +HS D+ NNLT AF Sbjct: 518 RQPYVTTHNHHSHDHNNNLTTAF 540 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,189,883 Number of Sequences: 59808 Number of extensions: 420121 Number of successful extensions: 1061 Number of sequences better than 10.0: 13 Number of HSP's better than 10.0 without gapping: 927 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1026 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1596754500 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -