BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0615 (683 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g31990.1 68415.m03908 exostosin family protein contains Pfam ... 28 5.0 At1g58602.1 68414.m06655 disease resistance protein (CC-NBS-LRR ... 28 6.6 At1g53790.1 68414.m06122 F-box family protein contains Pfam PF00... 28 6.6 At2g39280.1 68415.m04823 RabGAP/TBC domain-containing protein co... 27 8.8 At2g17033.2 68415.m01965 pentatricopeptide (PPR) repeat-containi... 27 8.8 At2g17033.1 68415.m01964 pentatricopeptide (PPR) repeat-containi... 27 8.8 At1g52910.1 68414.m05983 expressed protein 27 8.8 >At2g31990.1 68415.m03908 exostosin family protein contains Pfam profile: PF03016 Exostosin family Length = 479 Score = 28.3 bits (60), Expect = 5.0 Identities = 15/54 (27%), Positives = 26/54 (48%) Frame = +3 Query: 366 SRLQWGPHICKLANRLSSAAFAVKKIRTYTDEDTARLVYFSYFHSVMSYGILLW 527 SR WG + L+ L+ +++ R+ T + + Y +YFH + IL W Sbjct: 226 SRSAWGTNFMLLSESLNLTFLSIE--RSLTSHNEFAIPYPTYFHPTSTPEILQW 277 >At1g58602.1 68414.m06655 disease resistance protein (CC-NBS-LRR class), putative similar to diesease resistance protein rpp8 [Arabidopsis thaliana] gi|3901294|gb|AAC78631 Length = 1138 Score = 27.9 bits (59), Expect = 6.6 Identities = 10/29 (34%), Positives = 18/29 (62%) Frame = +1 Query: 85 QSLLKPVTRSYYSLMIHPYCLKLNDNWKI 171 +S++ P Y++ P CLK +D+WK+ Sbjct: 307 ESIVAPTNTKYFNFK--PECLKTDDSWKL 333 >At1g53790.1 68414.m06122 F-box family protein contains Pfam PF00646: F-box domain; contains TIGRFAM TIGR01640 : F-box protein interaction domain Length = 444 Score = 27.9 bits (59), Expect = 6.6 Identities = 11/32 (34%), Positives = 21/32 (65%) Frame = +1 Query: 1 LPVSYLIWVFLRVPYWVPSYFLCISMIYQSLL 96 +P+ L+ +F RVP + F C+S +++S+L Sbjct: 82 IPIDLLMDIFSRVPAKSIARFRCVSKLWESIL 113 >At2g39280.1 68415.m04823 RabGAP/TBC domain-containing protein contains Pfam profile PF00566: TBC domain Length = 771 Score = 27.5 bits (58), Expect = 8.8 Identities = 14/52 (26%), Positives = 28/52 (53%), Gaps = 1/52 (1%) Frame = +3 Query: 21 MGVPQGSILGPFLFLVYINDLP-KFIETRHEVVLFADDTSLLFKIKRQLEDY 173 +GV + GP+ ++IN LP + + +V+LF + +LF+ L ++ Sbjct: 403 LGVQVACVTGPWFLTIFINMLPWESVLRVWDVLLFEGNRVMLFRTALALMEF 454 >At2g17033.2 68415.m01965 pentatricopeptide (PPR) repeat-containing protein contains Pfam profile PF01535: PPR repeat Length = 505 Score = 27.5 bits (58), Expect = 8.8 Identities = 17/54 (31%), Positives = 27/54 (50%) Frame = +3 Query: 357 TVDSRLQWGPHICKLANRLSSAAFAVKKIRTYTDEDTARLVYFSYFHSVMSYGI 518 T +S L P I + L S ++ ++RT+ +ED A LV+ SV+ I Sbjct: 351 TYNSVLNSCPTIISMLKDLDSCPVSLSELRTFLNEDEALLVHELTQSSVLDEAI 404 >At2g17033.1 68415.m01964 pentatricopeptide (PPR) repeat-containing protein contains Pfam profile PF01535: PPR repeat Length = 504 Score = 27.5 bits (58), Expect = 8.8 Identities = 17/54 (31%), Positives = 27/54 (50%) Frame = +3 Query: 357 TVDSRLQWGPHICKLANRLSSAAFAVKKIRTYTDEDTARLVYFSYFHSVMSYGI 518 T +S L P I + L S ++ ++RT+ +ED A LV+ SV+ I Sbjct: 350 TYNSVLNSCPTIISMLKDLDSCPVSLSELRTFLNEDEALLVHELTQSSVLDEAI 403 >At1g52910.1 68414.m05983 expressed protein Length = 175 Score = 27.5 bits (58), Expect = 8.8 Identities = 17/41 (41%), Positives = 25/41 (60%), Gaps = 1/41 (2%) Frame = +1 Query: 478 FISVIFIVLCPMAFCCG-AMLPMSKRFSSCRRGLFVLFIIC 597 FIS + I++ FCCG A+ P R +C G+ +LF+IC Sbjct: 63 FISQVIIMVASRCFCCGKALKPGGSR--AC--GI-MLFLIC 98 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,685,393 Number of Sequences: 28952 Number of extensions: 300531 Number of successful extensions: 774 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 756 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 774 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1447936096 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -