BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0614 (505 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value U81038-1|AAB39355.1| 412|Tribolium castaneum transcription fact... 24 0.89 EF222291-1|ABN79651.1| 374|Tribolium castaneum cardioactive pep... 24 0.89 AF321227-3|AAK16423.1| 412|Tribolium castaneum Dfd protein. 24 0.89 AY884065-1|AAX84206.1| 697|Tribolium castaneum laccase 1 protein. 23 1.6 AY055847-1|AAL23667.2| 312|Tribolium castaneum cephalothorax pr... 23 1.6 AY055846-1|AAL26542.2| 312|Tribolium castaneum cephalothorax pr... 23 1.6 AF426396-1|AAL27023.2| 312|Tribolium castaneum cephalothorax pr... 23 1.6 AF416773-1|AAL09697.1| 268|Tribolium castaneum cephalothorax pr... 23 1.6 AF321227-2|AAK16422.1| 312|Tribolium castaneum Scr protein. 23 1.6 AF264695-1|AAG13009.1| 100|Tribolium castaneum cephalothorax pr... 23 1.6 AF227628-1|AAF42868.1| 312|Tribolium castaneum sex combs reduce... 23 1.6 AY531877-1|AAT08872.1| 247|Tribolium castaneum ORF1p protein. 23 2.1 EF222292-1|ABN79652.1| 354|Tribolium castaneum cardioactive pep... 22 2.7 AY043292-1|AAK96031.1| 323|Tribolium castaneum homeodomain tran... 22 2.7 AF228509-1|AAF69136.1| 325|Tribolium castaneum prothoraxless pr... 22 2.7 EF222293-1|ABN79653.1| 434|Tribolium castaneum ecdysis triggeri... 22 3.6 DQ342040-1|ABC69932.1| 822|Tribolium castaneum STIP protein. 21 6.3 AM292344-1|CAL23156.1| 291|Tribolium castaneum gustatory recept... 21 8.3 >U81038-1|AAB39355.1| 412|Tribolium castaneum transcription factor Deformed protein. Length = 412 Score = 23.8 bits (49), Expect = 0.89 Identities = 14/42 (33%), Positives = 23/42 (54%) Frame = -1 Query: 499 KIKKKNLLSRYP*RAHCYLIRTKRMLSDSQIFIYFINLRVAW 374 +++K+ +RY R I +LS+ QI I+F N R+ W Sbjct: 247 ELEKEFHYNRYLTRRRRIEIAHTLVLSERQIKIWFQNRRMKW 288 >EF222291-1|ABN79651.1| 374|Tribolium castaneum cardioactive peptide receptor 1 protein. Length = 374 Score = 23.8 bits (49), Expect = 0.89 Identities = 11/23 (47%), Positives = 14/23 (60%) Frame = -2 Query: 471 DILDVHTVI*YALNACCPILRFL 403 DI+ TV YA N C ++RFL Sbjct: 81 DIIWKTTVAWYAGNVACKVIRFL 103 >AF321227-3|AAK16423.1| 412|Tribolium castaneum Dfd protein. Length = 412 Score = 23.8 bits (49), Expect = 0.89 Identities = 14/42 (33%), Positives = 23/42 (54%) Frame = -1 Query: 499 KIKKKNLLSRYP*RAHCYLIRTKRMLSDSQIFIYFINLRVAW 374 +++K+ +RY R I +LS+ QI I+F N R+ W Sbjct: 247 ELEKEFHYNRYLTRRRRIEIAHTLVLSERQIKIWFQNRRMKW 288 >AY884065-1|AAX84206.1| 697|Tribolium castaneum laccase 1 protein. Length = 697 Score = 23.0 bits (47), Expect = 1.6 Identities = 17/66 (25%), Positives = 28/66 (42%), Gaps = 7/66 (10%) Frame = +1 Query: 202 IWAILRCFVQNISPFCTSL*SHITRFVTTRVFAGTYLPCERRS-------TCRYLYCIRQ 360 ++ I+ CF +N+S ++ + V PC R+ TCRY + + Sbjct: 6 LFMIIICFERNLSYKVMYNGNNNVTDLVEYVLLNEDNPCARKCVKDSVPMTCRYTFLLEW 65 Query: 361 YRLLSK 378 Y LSK Sbjct: 66 YHTLSK 71 >AY055847-1|AAL23667.2| 312|Tribolium castaneum cephalothorax protein. Length = 312 Score = 23.0 bits (47), Expect = 1.6 Identities = 17/56 (30%), Positives = 27/56 (48%), Gaps = 1/56 (1%) Frame = -1 Query: 499 KIKKKNLLSRYP*RAHCYLIRTKRMLSDSQIFIYFINLRVAW-TEGGIVGYNIGTY 335 +++K+ +RY R I L++ QI I+F N R+ W E + NI Y Sbjct: 234 ELEKEFHFNRYLTRRRRIEIAHALCLTERQIKIWFQNRRMKWKKEHKMASMNIVPY 289 >AY055846-1|AAL26542.2| 312|Tribolium castaneum cephalothorax protein. Length = 312 Score = 23.0 bits (47), Expect = 1.6 Identities = 17/56 (30%), Positives = 27/56 (48%), Gaps = 1/56 (1%) Frame = -1 Query: 499 KIKKKNLLSRYP*RAHCYLIRTKRMLSDSQIFIYFINLRVAW-TEGGIVGYNIGTY 335 +++K+ +RY R I L++ QI I+F N R+ W E + NI Y Sbjct: 234 ELEKEFHFNRYLTRRRRIEIAHALCLTERQIKIWFQNRRMKWKKEHKMASMNIVPY 289 >AF426396-1|AAL27023.2| 312|Tribolium castaneum cephalothorax protein. Length = 312 Score = 23.0 bits (47), Expect = 1.6 Identities = 17/56 (30%), Positives = 27/56 (48%), Gaps = 1/56 (1%) Frame = -1 Query: 499 KIKKKNLLSRYP*RAHCYLIRTKRMLSDSQIFIYFINLRVAW-TEGGIVGYNIGTY 335 +++K+ +RY R I L++ QI I+F N R+ W E + NI Y Sbjct: 234 ELEKEFHFNRYLTRRRRIEIAHALCLTERQIKIWFQNRRMKWKKEHKMASMNIVPY 289 >AF416773-1|AAL09697.1| 268|Tribolium castaneum cephalothorax protein. Length = 268 Score = 23.0 bits (47), Expect = 1.6 Identities = 17/56 (30%), Positives = 27/56 (48%), Gaps = 1/56 (1%) Frame = -1 Query: 499 KIKKKNLLSRYP*RAHCYLIRTKRMLSDSQIFIYFINLRVAW-TEGGIVGYNIGTY 335 +++K+ +RY R I L++ QI I+F N R+ W E + NI Y Sbjct: 190 ELEKEFHFNRYLTRRRRIEIAHALCLTERQIKIWFQNRRMKWKKEHKMASMNIVPY 245 >AF321227-2|AAK16422.1| 312|Tribolium castaneum Scr protein. Length = 312 Score = 23.0 bits (47), Expect = 1.6 Identities = 17/56 (30%), Positives = 27/56 (48%), Gaps = 1/56 (1%) Frame = -1 Query: 499 KIKKKNLLSRYP*RAHCYLIRTKRMLSDSQIFIYFINLRVAW-TEGGIVGYNIGTY 335 +++K+ +RY R I L++ QI I+F N R+ W E + NI Y Sbjct: 234 ELEKEFHFNRYLTRRRRIEIAHALCLTERQIKIWFQNRRMKWKKEHKMASMNIVPY 289 >AF264695-1|AAG13009.1| 100|Tribolium castaneum cephalothorax protein. Length = 100 Score = 23.0 bits (47), Expect = 1.6 Identities = 17/56 (30%), Positives = 27/56 (48%), Gaps = 1/56 (1%) Frame = -1 Query: 499 KIKKKNLLSRYP*RAHCYLIRTKRMLSDSQIFIYFINLRVAW-TEGGIVGYNIGTY 335 +++K+ +RY R I L++ QI I+F N R+ W E + NI Y Sbjct: 22 ELEKEFHFNRYLTRRRRIEIAHALCLTERQIKIWFQNRRMKWKKEHKMASMNIVPY 77 >AF227628-1|AAF42868.1| 312|Tribolium castaneum sex combs reduced Scr protein. Length = 312 Score = 23.0 bits (47), Expect = 1.6 Identities = 17/56 (30%), Positives = 27/56 (48%), Gaps = 1/56 (1%) Frame = -1 Query: 499 KIKKKNLLSRYP*RAHCYLIRTKRMLSDSQIFIYFINLRVAW-TEGGIVGYNIGTY 335 +++K+ +RY R I L++ QI I+F N R+ W E + NI Y Sbjct: 234 ELEKEFHFNRYLTRRRRIEIAHALCLTERQIKIWFQNRRMKWKKEHKMASMNIVPY 289 >AY531877-1|AAT08872.1| 247|Tribolium castaneum ORF1p protein. Length = 247 Score = 22.6 bits (46), Expect = 2.1 Identities = 8/21 (38%), Positives = 15/21 (71%) Frame = -1 Query: 487 KNLLSRYP*RAHCYLIRTKRM 425 K+LL +YP A+C L++ ++ Sbjct: 38 KDLLQKYPPIANCKLVQAPKL 58 >EF222292-1|ABN79652.1| 354|Tribolium castaneum cardioactive peptide receptor 2 protein. Length = 354 Score = 22.2 bits (45), Expect = 2.7 Identities = 10/17 (58%), Positives = 11/17 (64%) Frame = -2 Query: 453 TVI*YALNACCPILRFL 403 TV YA N C I+RFL Sbjct: 109 TVAWYAGNVLCKIIRFL 125 >AY043292-1|AAK96031.1| 323|Tribolium castaneum homeodomain transcription factor Prothoraxlessprotein. Length = 323 Score = 22.2 bits (45), Expect = 2.7 Identities = 13/42 (30%), Positives = 22/42 (52%) Frame = -1 Query: 499 KIKKKNLLSRYP*RAHCYLIRTKRMLSDSQIFIYFINLRVAW 374 +++K+ +RY R I L++ QI I+F N R+ W Sbjct: 256 ELEKEFHFNRYLTRRRRIEIAHALCLTERQIKIWFQNRRMKW 297 >AF228509-1|AAF69136.1| 325|Tribolium castaneum prothoraxless protein. Length = 325 Score = 22.2 bits (45), Expect = 2.7 Identities = 13/42 (30%), Positives = 22/42 (52%) Frame = -1 Query: 499 KIKKKNLLSRYP*RAHCYLIRTKRMLSDSQIFIYFINLRVAW 374 +++K+ +RY R I L++ QI I+F N R+ W Sbjct: 258 ELEKEFHFNRYLTRRRRIEIAHALCLTERQIKIWFQNRRMKW 299 >EF222293-1|ABN79653.1| 434|Tribolium castaneum ecdysis triggering hormone receptorisoform A protein. Length = 434 Score = 21.8 bits (44), Expect = 3.6 Identities = 7/19 (36%), Positives = 12/19 (63%) Frame = -2 Query: 198 FFNLLYMCA*CNFLNNVTN 142 ++N+LY C +LN+ N Sbjct: 329 YYNILYFCRIMVYLNSAIN 347 >DQ342040-1|ABC69932.1| 822|Tribolium castaneum STIP protein. Length = 822 Score = 21.0 bits (42), Expect = 6.3 Identities = 9/25 (36%), Positives = 11/25 (44%) Frame = +2 Query: 368 FCPSYTKIYEINKNLRIGQHAFSAY 442 F P K YE + RIG + Y Sbjct: 771 FVPIPNKYYEAKQVYRIGSNGLQCY 795 >AM292344-1|CAL23156.1| 291|Tribolium castaneum gustatory receptor candidate 23 protein. Length = 291 Score = 20.6 bits (41), Expect = 8.3 Identities = 8/23 (34%), Positives = 13/23 (56%) Frame = +2 Query: 50 IKNFKVSIKC*YSFNLYFGRIFT 118 +KN + + +N+ FG IFT Sbjct: 144 LKNCVIYFNRIFGWNILFGHIFT 166 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 119,199 Number of Sequences: 336 Number of extensions: 2690 Number of successful extensions: 23 Number of sequences better than 10.0: 18 Number of HSP's better than 10.0 without gapping: 23 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 23 length of database: 122,585 effective HSP length: 53 effective length of database: 104,777 effective search space used: 11944578 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -