BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0614 (505 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g13130.1 68417.m02045 DC1 domain-containing protein contains ... 27 9.5 At1g23230.1 68414.m02906 expressed protein 27 9.5 >At4g13130.1 68417.m02045 DC1 domain-containing protein contains Pfam protein PF03107 DC1 domain Length = 767 Score = 26.6 bits (56), Expect = 9.5 Identities = 13/41 (31%), Positives = 22/41 (53%), Gaps = 1/41 (2%) Frame = -2 Query: 276 PCYMRL*TSTKWRYVLNETSQNC-PYVFFNLLYMCA*CNFL 157 P ++R+ +T Y N+ Q C ++F +Y C CNF+ Sbjct: 459 PHHLRMDKNTGRDYDENKQCQACITPIYFGNIYSCMQCNFI 499 >At1g23230.1 68414.m02906 expressed protein Length = 1615 Score = 26.6 bits (56), Expect = 9.5 Identities = 10/26 (38%), Positives = 17/26 (65%) Frame = -3 Query: 260 YKLVQNGDMF*TKHLKIAHMYFLTYY 183 Y+L++N M +L +AH +FL Y+ Sbjct: 1130 YRLIENNAMEQADNLLLAHSHFLAYH 1155 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,165,531 Number of Sequences: 28952 Number of extensions: 198586 Number of successful extensions: 369 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 365 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 369 length of database: 12,070,560 effective HSP length: 76 effective length of database: 9,870,208 effective search space used: 898188928 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -