BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0613 (603 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_Q5ZP37 Cluster: Putative uncharacterized protein 8.1; n... 45 0.002 UniRef50_Q5ZZQ2 Cluster: Putative uncharacterized protein; n=6; ... 33 6.9 >UniRef50_Q5ZP37 Cluster: Putative uncharacterized protein 8.1; n=1; Cotesia congregata bracovirus|Rep: Putative uncharacterized protein 8.1 - Cotesia congregata bracovirus Length = 108 Score = 44.8 bits (101), Expect = 0.002 Identities = 23/28 (82%), Positives = 23/28 (82%) Frame = -1 Query: 213 SVESGAKFRSKIPL*TERQTTDCVYCEQ 130 SVESGAKFRS PL TERQTTDCVY Q Sbjct: 19 SVESGAKFRSN-PLSTERQTTDCVYSGQ 45 >UniRef50_Q5ZZQ2 Cluster: Putative uncharacterized protein; n=6; Mycoplasma hyopneumoniae|Rep: Putative uncharacterized protein - Mycoplasma hyopneumoniae (strain 232) Length = 945 Score = 32.7 bits (71), Expect = 6.9 Identities = 19/63 (30%), Positives = 35/63 (55%), Gaps = 2/63 (3%) Frame = +1 Query: 337 ILNMKVYLFITVAGKKPQKTLFGL*MHFTIWWLVQEFST*VHNNKEMTVTLHYLQ-EAN- 510 I+ K + FI + +K T+FGL HF++ W ++ F + NN+ + + ++ E N Sbjct: 359 IIMEKSFYFIPKSAEK--STVFGLSSHFSVLWYIKVFDFYLKNNQNILEIIQTIKTEINY 416 Query: 511 IFH 519 +FH Sbjct: 417 VFH 419 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 547,495,273 Number of Sequences: 1657284 Number of extensions: 10586686 Number of successful extensions: 20534 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 20065 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 20529 length of database: 575,637,011 effective HSP length: 97 effective length of database: 414,880,463 effective search space used: 42732687689 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -