BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0613 (603 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC12B10.14c |ppk2||serine/threonine protein kinase Ppk2 |Schiz... 26 3.7 SPAC1834.09 |mug51||conserved fungal protein|Schizosaccharomyces... 26 3.7 >SPAC12B10.14c |ppk2||serine/threonine protein kinase Ppk2 |Schizosaccharomyces pombe|chr 1|||Manual Length = 665 Score = 26.2 bits (55), Expect = 3.7 Identities = 19/79 (24%), Positives = 33/79 (41%), Gaps = 10/79 (12%) Frame = -1 Query: 309 NDFFWH*YNFTSIFAAVTQGSLLCNRYPRSTDS----------VESGAKFRSKIPL*TER 160 N+ FW+ N S+F + L P+ S + SG F + Sbjct: 449 NESFWYLNNIWSVFEYKDPSTKLSALIPKYFFSELNIASICYEISSGLAFLHNSGIAHHN 508 Query: 159 QTTDCVYCEQNSFLRLRNF 103 TT+C+Y ++S L++ N+ Sbjct: 509 LTTECIYLTKSSCLKIGNY 527 >SPAC1834.09 |mug51||conserved fungal protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 306 Score = 26.2 bits (55), Expect = 3.7 Identities = 9/30 (30%), Positives = 18/30 (60%) Frame = +3 Query: 342 KYESLFIYYCCR*KTTENFIWIMNALHNMV 431 +++ LF YY C+ K E+ ++ LH ++ Sbjct: 148 EFDKLFTYYLCKFKDQEHIYTLIFKLHKLL 177 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,406,493 Number of Sequences: 5004 Number of extensions: 49734 Number of successful extensions: 93 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 91 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 93 length of database: 2,362,478 effective HSP length: 69 effective length of database: 2,017,202 effective search space used: 264253462 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -