BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0613 (603 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 03_02_0030 + 5129234-5129568,5130020-5130651,5130936-5131243,513... 28 6.5 01_05_0121 - 18361285-18361560,18361828-18362073,18362331-18362519 27 8.7 >03_02_0030 + 5129234-5129568,5130020-5130651,5130936-5131243, 5131396-5131504,5131871-5131956,5132173-5132232, 5133164-5133340,5133742-5133780 Length = 581 Score = 27.9 bits (59), Expect = 6.5 Identities = 15/39 (38%), Positives = 18/39 (46%) Frame = -1 Query: 315 TKNDFFWH*YNFTSIFAAVTQGSLLCNRYPRSTDSVESG 199 TKN F WH Y F S F + + + Y S DS G Sbjct: 169 TKNPFSWHRYPFLSRFRSNSGDKKDTSHYVSSMDSEYEG 207 >01_05_0121 - 18361285-18361560,18361828-18362073,18362331-18362519 Length = 236 Score = 27.5 bits (58), Expect = 8.7 Identities = 13/30 (43%), Positives = 16/30 (53%) Frame = -2 Query: 476 ISLLLCTYVLNSCTSHHIVKCIHNPNKVFC 387 + LLL T N+CTSHH N +FC Sbjct: 10 LELLLSTQFFNTCTSHH--NSPRNECNLFC 37 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,828,868 Number of Sequences: 37544 Number of extensions: 261527 Number of successful extensions: 436 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 429 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 436 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1431112012 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -