BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0613 (603 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_45482| Best HMM Match : BTB (HMM E-Value=5.6e-11) 29 2.2 SB_20853| Best HMM Match : F-box (HMM E-Value=1.1e-05) 29 2.2 >SB_45482| Best HMM Match : BTB (HMM E-Value=5.6e-11) Length = 3037 Score = 29.5 bits (63), Expect = 2.2 Identities = 15/44 (34%), Positives = 22/44 (50%) Frame = +2 Query: 149 SVVWRSVYNGIFERNLAPDSTESVDLGYLLHRRLP*VTAANIDV 280 SV + N FE+NLA ++ DLG L + A N+D+ Sbjct: 689 SVTPKPEENNYFEKNLAIQKSQKEDLGKSLSESISDTQAVNVDI 732 >SB_20853| Best HMM Match : F-box (HMM E-Value=1.1e-05) Length = 637 Score = 29.5 bits (63), Expect = 2.2 Identities = 17/50 (34%), Positives = 28/50 (56%), Gaps = 1/50 (2%) Frame = +2 Query: 104 KFRNLKKLFCSQ*TQSVVWRSVYNGIFER-NLAPDSTESVDLGYLLHRRL 250 ++++ + LF + SV WR VY IF+R N +PD D+ Y + R+ Sbjct: 48 RWQSQRFLFANVPPSSVNWRKVYQEIFQRGNFSPD-----DMKYFISSRI 92 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,072,363 Number of Sequences: 59808 Number of extensions: 336831 Number of successful extensions: 614 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 517 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 614 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1463691625 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -