BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0612 (615 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g44070.1 68416.m04721 expressed protein ; expression supporte... 29 1.9 At1g09190.1 68414.m01026 pentatricopeptide (PPR) repeat-containi... 28 5.7 >At3g44070.1 68416.m04721 expressed protein ; expression supported by MPSS Length = 276 Score = 29.5 bits (63), Expect = 1.9 Identities = 17/49 (34%), Positives = 24/49 (48%) Frame = -3 Query: 193 LKPIKSKAAKSNSVKYSGKLQKSALNTSLRILLIHRSTALARASVSNTP 47 L+ K + S++Y +S L +L + L HRST ARA V P Sbjct: 121 LEDFKPFTLYTTSIRYGLPKLQSHLTAALPLNLTHRSTVFARALVKALP 169 >At1g09190.1 68414.m01026 pentatricopeptide (PPR) repeat-containing protein contains Pfam profile PF01535: PPR repeat Length = 999 Score = 27.9 bits (59), Expect = 5.7 Identities = 15/40 (37%), Positives = 25/40 (62%) Frame = -2 Query: 311 NYKLSLYNLFSIRGQIQNFTKLLRVMERNKLNDQSMNSTI 192 NY L L NL++ G+ Q+ K+ +M++N+L + STI Sbjct: 956 NYVL-LSNLYAEEGRWQDVEKVRTLMKKNRLRKSTGQSTI 994 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,914,497 Number of Sequences: 28952 Number of extensions: 220141 Number of successful extensions: 393 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 384 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 393 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1236350304 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -