BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0611 (752 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_24568| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.4 SB_22884| Best HMM Match : Tctex-1 (HMM E-Value=9.4e-26) 28 9.4 >SB_24568| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1109 Score = 28.7 bits (61), Expect = 5.4 Identities = 21/56 (37%), Positives = 29/56 (51%), Gaps = 3/56 (5%) Frame = +3 Query: 555 FVCTVIILY*VYF-CMKCL--PAEKKQSKDVMKKKNVTK*IFKHFLMRIFDNSRLI 713 F T+IIL V C + L PAEKKQ D +KK N++ K +I + + I Sbjct: 98 FRSTIIILQCVCKNCCRVLLPPAEKKQFLDTLKKPNISSLAKKGMKKKIVEKCKKI 153 >SB_22884| Best HMM Match : Tctex-1 (HMM E-Value=9.4e-26) Length = 439 Score = 27.9 bits (59), Expect = 9.4 Identities = 18/51 (35%), Positives = 27/51 (52%) Frame = -3 Query: 480 IVNLYKEALHKSNKNLKKHSFFSYTLSKFNMGEIVS*ATIYIHYLPEIFEI 328 I L K+A+ ++ L +F +YT +F G + AT+Y Y E FEI Sbjct: 132 IGQLGKQAMRIGSRCLWDANFDTYTTYEFKNGSLFGVATVYGVYFDE-FEI 181 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,661,066 Number of Sequences: 59808 Number of extensions: 339268 Number of successful extensions: 559 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 521 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 557 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 2046258890 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -