BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0608 (765 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ869051-1|ABJ09598.1| 581|Apis mellifera pyrokinin-like recept... 24 1.3 AY823258-1|AAX18443.1| 145|Apis mellifera pburs protein. 22 5.4 AM420632-1|CAM06632.1| 145|Apis mellifera bursicon subunit beta... 22 5.4 DQ667184-1|ABG75736.1| 489|Apis mellifera GABA-gated ion channe... 22 7.2 DQ667192-1|ABG75744.1| 489|Apis mellifera pH-sensitive chloride... 21 9.5 DQ667191-1|ABG75743.1| 475|Apis mellifera pH-sensitive chloride... 21 9.5 DQ667190-1|ABG75742.1| 509|Apis mellifera pH-sensitive chloride... 21 9.5 DQ667189-1|ABG75741.1| 458|Apis mellifera pH-sensitive chloride... 21 9.5 >DQ869051-1|ABJ09598.1| 581|Apis mellifera pyrokinin-like receptor 2 protein. Length = 581 Score = 24.2 bits (50), Expect = 1.3 Identities = 13/42 (30%), Positives = 25/42 (59%), Gaps = 2/42 (4%) Frame = -3 Query: 172 LWILLVVTMCRYIL--SSILTYV*TCIYHKK*KSCRCATHYY 53 L+I+L +T+ ++ + ++ V TC+ + KS AT+YY Sbjct: 50 LYIVLPITVIYAVIFVTGLVGNVSTCVVIARNKSMHTATNYY 91 >AY823258-1|AAX18443.1| 145|Apis mellifera pburs protein. Length = 145 Score = 22.2 bits (45), Expect = 5.4 Identities = 8/21 (38%), Positives = 15/21 (71%) Frame = +1 Query: 496 DNFTILFVLSHLILFCIYILS 558 +NF+I+F+ S ++ I+I S Sbjct: 3 ENFSIMFIHSIFLILIIFIYS 23 >AM420632-1|CAM06632.1| 145|Apis mellifera bursicon subunit beta protein precursor protein. Length = 145 Score = 22.2 bits (45), Expect = 5.4 Identities = 8/21 (38%), Positives = 15/21 (71%) Frame = +1 Query: 496 DNFTILFVLSHLILFCIYILS 558 +NF+I+F+ S ++ I+I S Sbjct: 3 ENFSIMFIHSIFLILIIFIYS 23 >DQ667184-1|ABG75736.1| 489|Apis mellifera GABA-gated ion channel protein. Length = 489 Score = 21.8 bits (44), Expect = 7.2 Identities = 12/30 (40%), Positives = 15/30 (50%) Frame = -1 Query: 255 YVITRSIRNYFKDEKYKVISWESFVLYFCG 166 Y IT + Y+KDE+ S E VL G Sbjct: 82 YTITMYLNQYWKDERL-AFSQEEEVLTLSG 110 >DQ667192-1|ABG75744.1| 489|Apis mellifera pH-sensitive chloride channel variant 4 protein. Length = 489 Score = 21.4 bits (43), Expect = 9.5 Identities = 9/17 (52%), Positives = 10/17 (58%) Frame = +1 Query: 187 TFPRYYFVFLVLKIITY 237 TFP YF+FL I Y Sbjct: 469 TFPVAYFMFLTFFFIHY 485 >DQ667191-1|ABG75743.1| 475|Apis mellifera pH-sensitive chloride channel variant 3 protein. Length = 475 Score = 21.4 bits (43), Expect = 9.5 Identities = 9/17 (52%), Positives = 10/17 (58%) Frame = +1 Query: 187 TFPRYYFVFLVLKIITY 237 TFP YF+FL I Y Sbjct: 455 TFPVAYFMFLTFFFIHY 471 >DQ667190-1|ABG75742.1| 509|Apis mellifera pH-sensitive chloride channel variant 1 protein. Length = 509 Score = 21.4 bits (43), Expect = 9.5 Identities = 9/17 (52%), Positives = 10/17 (58%) Frame = +1 Query: 187 TFPRYYFVFLVLKIITY 237 TFP YF+FL I Y Sbjct: 489 TFPVAYFMFLTFFFIHY 505 >DQ667189-1|ABG75741.1| 458|Apis mellifera pH-sensitive chloride channel protein. Length = 458 Score = 21.4 bits (43), Expect = 9.5 Identities = 9/17 (52%), Positives = 10/17 (58%) Frame = +1 Query: 187 TFPRYYFVFLVLKIITY 237 TFP YF+FL I Y Sbjct: 438 TFPVAYFMFLTFFFIHY 454 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 159,497 Number of Sequences: 438 Number of extensions: 2504 Number of successful extensions: 10 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 10 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 23911269 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -