BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0604 (753 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AF317551-1|AAG39634.1| 312|Tribolium castaneum distal-less prot... 23 2.6 AY055847-1|AAL23667.2| 312|Tribolium castaneum cephalothorax pr... 23 3.5 AY055846-1|AAL26542.2| 312|Tribolium castaneum cephalothorax pr... 23 3.5 AY055845-1|AAL23670.2| 230|Tribolium castaneum cephalothorax pr... 23 3.5 AF426396-1|AAL27023.2| 312|Tribolium castaneum cephalothorax pr... 23 3.5 AF426395-1|AAL27022.2| 297|Tribolium castaneum cephalothorax pr... 23 3.5 AF416773-1|AAL09697.1| 268|Tribolium castaneum cephalothorax pr... 23 3.5 AF321227-2|AAK16422.1| 312|Tribolium castaneum Scr protein. 23 3.5 AF261823-1|AAG13010.1| 157|Tribolium castaneum cephalothorax pr... 23 3.5 AF227628-1|AAF42868.1| 312|Tribolium castaneum sex combs reduce... 23 3.5 AM292337-1|CAL23149.2| 452|Tribolium castaneum gustatory recept... 22 4.6 EF222293-1|ABN79653.1| 434|Tribolium castaneum ecdysis triggeri... 21 8.0 AY884065-1|AAX84206.1| 697|Tribolium castaneum laccase 1 protein. 21 8.0 >AF317551-1|AAG39634.1| 312|Tribolium castaneum distal-less protein. Length = 312 Score = 23.0 bits (47), Expect = 2.6 Identities = 9/26 (34%), Positives = 16/26 (61%) Frame = +1 Query: 112 LAGNNAPANKVAQLFKRSRTYINRTT 189 LAG ++P+N+ + + RT+ TT Sbjct: 259 LAGTSSPSNRFTRHLIQRRTHTRHTT 284 >AY055847-1|AAL23667.2| 312|Tribolium castaneum cephalothorax protein. Length = 312 Score = 22.6 bits (46), Expect = 3.5 Identities = 10/24 (41%), Positives = 13/24 (54%) Frame = +2 Query: 89 PTDLPEIFSPATMHPPIKSPSFSN 160 P DL +P PP+ +PS SN Sbjct: 113 PQDLSTNGAPPRSTPPLSTPSNSN 136 >AY055846-1|AAL26542.2| 312|Tribolium castaneum cephalothorax protein. Length = 312 Score = 22.6 bits (46), Expect = 3.5 Identities = 10/24 (41%), Positives = 13/24 (54%) Frame = +2 Query: 89 PTDLPEIFSPATMHPPIKSPSFSN 160 P DL +P PP+ +PS SN Sbjct: 113 PQDLSTNGAPPRSTPPLSTPSNSN 136 >AY055845-1|AAL23670.2| 230|Tribolium castaneum cephalothorax protein. Length = 230 Score = 22.6 bits (46), Expect = 3.5 Identities = 10/24 (41%), Positives = 13/24 (54%) Frame = +2 Query: 89 PTDLPEIFSPATMHPPIKSPSFSN 160 P DL +P PP+ +PS SN Sbjct: 113 PQDLSTNGAPPRSTPPLSTPSNSN 136 >AF426396-1|AAL27023.2| 312|Tribolium castaneum cephalothorax protein. Length = 312 Score = 22.6 bits (46), Expect = 3.5 Identities = 10/24 (41%), Positives = 13/24 (54%) Frame = +2 Query: 89 PTDLPEIFSPATMHPPIKSPSFSN 160 P DL +P PP+ +PS SN Sbjct: 113 PQDLSTNGAPPRSTPPLSTPSNSN 136 >AF426395-1|AAL27022.2| 297|Tribolium castaneum cephalothorax protein. Length = 297 Score = 22.6 bits (46), Expect = 3.5 Identities = 10/24 (41%), Positives = 13/24 (54%) Frame = +2 Query: 89 PTDLPEIFSPATMHPPIKSPSFSN 160 P DL +P PP+ +PS SN Sbjct: 113 PQDLSTNGAPPRSTPPLSTPSNSN 136 >AF416773-1|AAL09697.1| 268|Tribolium castaneum cephalothorax protein. Length = 268 Score = 22.6 bits (46), Expect = 3.5 Identities = 10/24 (41%), Positives = 13/24 (54%) Frame = +2 Query: 89 PTDLPEIFSPATMHPPIKSPSFSN 160 P DL +P PP+ +PS SN Sbjct: 69 PQDLSTNGAPPRSTPPLSTPSNSN 92 >AF321227-2|AAK16422.1| 312|Tribolium castaneum Scr protein. Length = 312 Score = 22.6 bits (46), Expect = 3.5 Identities = 10/24 (41%), Positives = 13/24 (54%) Frame = +2 Query: 89 PTDLPEIFSPATMHPPIKSPSFSN 160 P DL +P PP+ +PS SN Sbjct: 113 PQDLSTNGAPPRSTPPLSTPSNSN 136 >AF261823-1|AAG13010.1| 157|Tribolium castaneum cephalothorax protein. Length = 157 Score = 22.6 bits (46), Expect = 3.5 Identities = 10/24 (41%), Positives = 13/24 (54%) Frame = +2 Query: 89 PTDLPEIFSPATMHPPIKSPSFSN 160 P DL +P PP+ +PS SN Sbjct: 113 PQDLSTNGAPPRSTPPLSTPSNSN 136 >AF227628-1|AAF42868.1| 312|Tribolium castaneum sex combs reduced Scr protein. Length = 312 Score = 22.6 bits (46), Expect = 3.5 Identities = 10/24 (41%), Positives = 13/24 (54%) Frame = +2 Query: 89 PTDLPEIFSPATMHPPIKSPSFSN 160 P DL +P PP+ +PS SN Sbjct: 113 PQDLSTNGAPPRSTPPLSTPSNSN 136 >AM292337-1|CAL23149.2| 452|Tribolium castaneum gustatory receptor candidate 16 protein. Length = 452 Score = 22.2 bits (45), Expect = 4.6 Identities = 8/19 (42%), Positives = 14/19 (73%) Frame = +3 Query: 693 YK*VGVVCTLSHFVFYCIL 749 Y +G+V T+++FV + IL Sbjct: 34 YSKIGIVQTVAYFVIFIIL 52 >EF222293-1|ABN79653.1| 434|Tribolium castaneum ecdysis triggering hormone receptorisoform A protein. Length = 434 Score = 21.4 bits (43), Expect = 8.0 Identities = 11/48 (22%), Positives = 25/48 (52%) Frame = -1 Query: 519 YLCNNIELLLIIWSTLIYSYRIHHSNLK*HYIHLF*LQCNVC*NSELS 376 +LC + I+W L+ +++H ++ +Y L+ + V NS ++ Sbjct: 300 FLCLIPFRVFILWIILVPEEQVYHLEIEKYYNILYFCRIMVYLNSAIN 347 >AY884065-1|AAX84206.1| 697|Tribolium castaneum laccase 1 protein. Length = 697 Score = 21.4 bits (43), Expect = 8.0 Identities = 10/34 (29%), Positives = 19/34 (55%) Frame = +1 Query: 559 FQQHLNLNHS*IFILTSQTRKSQEFRYR*NTILA 660 F+ + ++S +F+ T++ Q +RYR I A Sbjct: 254 FKHFVGADNSTVFVPTARFTVEQGYRYRFRVINA 287 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 159,240 Number of Sequences: 336 Number of extensions: 3336 Number of successful extensions: 19 Number of sequences better than 10.0: 13 Number of HSP's better than 10.0 without gapping: 19 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 19 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 20131186 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -