BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0604 (753 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U41263-4|AAC24426.4| 779|Caenorhabditis elegans Hypothetical pr... 35 0.054 AC024843-5|AAK70666.3| 740|Caenorhabditis elegans Hypothetical ... 28 6.2 >U41263-4|AAC24426.4| 779|Caenorhabditis elegans Hypothetical protein T19D12.6 protein. Length = 779 Score = 35.1 bits (77), Expect = 0.054 Identities = 14/45 (31%), Positives = 27/45 (60%) Frame = +2 Query: 17 LTAEKPSENERSSKIPQIQIYEVRPTDLPEIFSPATMHPPIKSPS 151 +T +K ++NE S I QI+++++ +P+I MH +SP+ Sbjct: 306 MTGDKENDNEESDDIIQIEMFDLTQRGIPKILETPGMHMSTQSPT 350 >AC024843-5|AAK70666.3| 740|Caenorhabditis elegans Hypothetical protein Y61A9LA.8 protein. Length = 740 Score = 28.3 bits (60), Expect = 6.2 Identities = 12/32 (37%), Positives = 19/32 (59%) Frame = +2 Query: 14 ELTAEKPSENERSSKIPQIQIYEVRPTDLPEI 109 E EK ENE ++ P+ ++ V+P LP+I Sbjct: 634 EKKEEKSDENESKAEEPKAEVAPVQPKPLPDI 665 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,901,639 Number of Sequences: 27780 Number of extensions: 286531 Number of successful extensions: 794 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 757 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 794 length of database: 12,740,198 effective HSP length: 80 effective length of database: 10,517,798 effective search space used: 1788025660 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -