BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0601 (701 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ026034-1|AAY87893.1| 569|Apis mellifera nicotinic acetylcholi... 23 3.7 DQ026033-1|AAY87892.1| 569|Apis mellifera nicotinic acetylcholi... 23 3.7 DQ026032-1|AAY87891.1| 566|Apis mellifera nicotinic acetylcholi... 22 6.5 DQ026031-1|AAY87890.1| 601|Apis mellifera nicotinic acetylcholi... 22 6.5 >DQ026034-1|AAY87893.1| 569|Apis mellifera nicotinic acetylcholine receptor alpha4subunit protein. Length = 569 Score = 22.6 bits (46), Expect = 3.7 Identities = 13/42 (30%), Positives = 21/42 (50%) Frame = +3 Query: 498 CATFIFVIKSAFYLVSASTVRLQLSLLHSNRLNKFFVMIFYI 623 C F+ FYL S S ++ LS+ L+ FF+++ I Sbjct: 255 CMGISFLTVLTFYLPSDSGEKVTLSISILISLHVFFLLVVEI 296 >DQ026033-1|AAY87892.1| 569|Apis mellifera nicotinic acetylcholine receptor alpha4subunit protein. Length = 569 Score = 22.6 bits (46), Expect = 3.7 Identities = 13/42 (30%), Positives = 21/42 (50%) Frame = +3 Query: 498 CATFIFVIKSAFYLVSASTVRLQLSLLHSNRLNKFFVMIFYI 623 C F+ FYL S S ++ LS+ L+ FF+++ I Sbjct: 255 CMGISFLTVLTFYLPSDSGEKVTLSISILISLHVFFLLVVEI 296 >DQ026032-1|AAY87891.1| 566|Apis mellifera nicotinic acetylcholine receptor alpha3subunit protein. Length = 566 Score = 21.8 bits (44), Expect = 6.5 Identities = 12/39 (30%), Positives = 19/39 (48%) Frame = +3 Query: 498 CATFIFVIKSAFYLVSASTVRLQLSLLHSNRLNKFFVMI 614 C F+ FYL S S ++ LS+ L FF+++ Sbjct: 251 CMGISFLTVLVFYLPSDSGEKVSLSISILLSLTVFFLLL 289 >DQ026031-1|AAY87890.1| 601|Apis mellifera nicotinic acetylcholine receptor alpha1subunit protein. Length = 601 Score = 21.8 bits (44), Expect = 6.5 Identities = 12/39 (30%), Positives = 19/39 (48%) Frame = +3 Query: 498 CATFIFVIKSAFYLVSASTVRLQLSLLHSNRLNKFFVMI 614 C F+ FYL S S ++ LS+ L FF+++ Sbjct: 247 CVGISFLSVLVFYLPSDSGEKVSLSISILLSLTVFFLLL 285 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 202,997 Number of Sequences: 438 Number of extensions: 4261 Number of successful extensions: 8 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 21561255 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -