BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0599 (596 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB204558-1|BAD89803.1| 1143|Apis mellifera nitric oxide synthase... 22 5.3 AY855337-1|AAW47987.1| 510|Apis mellifera tyrosine hydroxylase ... 21 6.9 AY656663-1|AAT68000.1| 148|Apis mellifera pteropsin protein. 21 6.9 AB208108-1|BAE72140.1| 92|Apis mellifera Broad complex zinc fi... 21 6.9 AB204559-1|BAD89804.1| 832|Apis mellifera soluble guanylyl cycl... 21 6.9 DQ435327-1|ABD92642.1| 145|Apis mellifera OBP10 protein. 21 9.2 AY127579-1|AAN02286.1| 405|Apis mellifera venom protease precur... 21 9.2 AF388659-4|AAK71996.1| 1308|Apis mellifera NFRKB-like protein pr... 21 9.2 >AB204558-1|BAD89803.1| 1143|Apis mellifera nitric oxide synthase protein. Length = 1143 Score = 21.8 bits (44), Expect = 5.3 Identities = 9/23 (39%), Positives = 12/23 (52%) Frame = +3 Query: 144 PPVNRLLRHQPQVATRPSSADRL 212 PP LLR+ +AT P +L Sbjct: 827 PPTPNLLRYFASIATNPKEQAQL 849 >AY855337-1|AAW47987.1| 510|Apis mellifera tyrosine hydroxylase protein. Length = 510 Score = 21.4 bits (43), Expect = 6.9 Identities = 8/23 (34%), Positives = 14/23 (60%) Frame = -2 Query: 250 LAFIPIFTNPRFFKRSAELGLVA 182 L +P+ +P F + S E+GL + Sbjct: 341 LGHMPLLADPSFAQFSQEIGLAS 363 >AY656663-1|AAT68000.1| 148|Apis mellifera pteropsin protein. Length = 148 Score = 21.4 bits (43), Expect = 6.9 Identities = 9/32 (28%), Positives = 17/32 (53%) Frame = +2 Query: 17 ANSVSSGLSWEQHPVLSRASSVPAHRALAGLL 112 A +VS +SWE H ++ + + + GL+ Sbjct: 44 AGNVSCSVSWEVHDPVTNSDTYIGFLFVLGLI 75 >AB208108-1|BAE72140.1| 92|Apis mellifera Broad complex zinc finger domain-Z3 isoform protein. Length = 92 Score = 21.4 bits (43), Expect = 6.9 Identities = 9/14 (64%), Positives = 11/14 (78%) Frame = +1 Query: 154 TGSSATSHKSLQDR 195 T +S T+HKSLQ R Sbjct: 47 TKNSLTTHKSLQHR 60 >AB204559-1|BAD89804.1| 832|Apis mellifera soluble guanylyl cyclase beta-3 protein. Length = 832 Score = 21.4 bits (43), Expect = 6.9 Identities = 12/34 (35%), Positives = 17/34 (50%) Frame = +1 Query: 463 ERRVAIATLAAFSIDALLFTCDVATSTSHSFRFS 564 E+RV+ T AAF+I ++ S S R S Sbjct: 622 EKRVSAGTPAAFNISTTIYENQNCLDASSSRRGS 655 >DQ435327-1|ABD92642.1| 145|Apis mellifera OBP10 protein. Length = 145 Score = 21.0 bits (42), Expect = 9.2 Identities = 9/26 (34%), Positives = 16/26 (61%), Gaps = 1/26 (3%) Frame = +2 Query: 185 YKTELCRPFEEA-GVCKYGDKCQFAH 259 Y+ E+ + E G+ K GD C++A+ Sbjct: 104 YRAEVQKAISECKGIAK-GDNCEYAY 128 >AY127579-1|AAN02286.1| 405|Apis mellifera venom protease precursor protein. Length = 405 Score = 21.0 bits (42), Expect = 9.2 Identities = 7/12 (58%), Positives = 7/12 (58%) Frame = -2 Query: 178 CGWWRRSRFTGG 143 CGW SR GG Sbjct: 153 CGWKNPSRIVGG 164 >AF388659-4|AAK71996.1| 1308|Apis mellifera NFRKB-like protein protein. Length = 1308 Score = 21.0 bits (42), Expect = 9.2 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = -3 Query: 336 PTEWKVR 316 PTEWKVR Sbjct: 582 PTEWKVR 588 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 151,187 Number of Sequences: 438 Number of extensions: 2816 Number of successful extensions: 9 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 17482179 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -