BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0598 (749 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPCC613.12c |raf1|dos1, cmc1, clr8|Rik1-associated factor Raf1|S... 26 5.0 SPAC6F6.01 |||VIC sodium channel |Schizosaccharomyces pombe|chr ... 26 6.6 SPAC25B8.04c |||mitochondrial splicing suppressor |Schizosacchar... 25 8.7 >SPCC613.12c |raf1|dos1, cmc1, clr8|Rik1-associated factor Raf1|Schizosaccharomyces pombe|chr 3|||Manual Length = 638 Score = 26.2 bits (55), Expect = 5.0 Identities = 11/26 (42%), Positives = 16/26 (61%) Frame = +1 Query: 313 ILSLRNHFNLNFIGITLRKTIENLCY 390 I SL +H+ LN +G TI +LC+ Sbjct: 282 IQSLESHYKLNQVGEKEYSTISDLCF 307 >SPAC6F6.01 |||VIC sodium channel |Schizosaccharomyces pombe|chr 1|||Manual Length = 1854 Score = 25.8 bits (54), Expect = 6.6 Identities = 18/52 (34%), Positives = 24/52 (46%), Gaps = 1/52 (1%) Frame = +3 Query: 252 FSFCVYFSMDYVSCITHRVKNFKPS-EPF*SQFYWYYPKKNH*KFVLYLEKV 404 FS+ S + + + + FK S PF Y PK+N KFVL L V Sbjct: 1509 FSYIHTKSSSFTNLQRNDFRQFKDSWAPFDPMVTGYIPKRNAVKFVLSLRGV 1560 >SPAC25B8.04c |||mitochondrial splicing suppressor |Schizosaccharomyces pombe|chr 1|||Manual Length = 378 Score = 25.4 bits (53), Expect = 8.7 Identities = 12/37 (32%), Positives = 20/37 (54%) Frame = +3 Query: 264 VYFSMDYVSCITHRVKNFKPSEPF*SQFYWYYPKKNH 374 ++F DY + HRV F+P +P+ F+ P +H Sbjct: 248 LHFHQDYYHNL-HRVGAFEPFDPYYDTFFLPMPLISH 283 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,967,360 Number of Sequences: 5004 Number of extensions: 60713 Number of successful extensions: 127 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 124 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 127 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 357280532 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -