BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0598 (749 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_45531| Best HMM Match : 7tm_1 (HMM E-Value=6.6e-25) 29 4.0 SB_38598| Best HMM Match : 7tm_1 (HMM E-Value=1.4e-07) 28 7.0 SB_52311| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.0 >SB_45531| Best HMM Match : 7tm_1 (HMM E-Value=6.6e-25) Length = 387 Score = 29.1 bits (62), Expect = 4.0 Identities = 12/27 (44%), Positives = 17/27 (62%) Frame = +1 Query: 667 IFSICDRG*GLVDILYITVGCCQFVVT 747 + +C LVD+L +T+GC Q VVT Sbjct: 15 VLLLCIGALALVDVLMLTLGCWQIVVT 41 >SB_38598| Best HMM Match : 7tm_1 (HMM E-Value=1.4e-07) Length = 336 Score = 28.3 bits (60), Expect = 7.0 Identities = 15/42 (35%), Positives = 22/42 (52%) Frame = +2 Query: 260 LRIFFNGLCIVYNASCKKF*AFGTILISILLVLP*EKPLKIC 385 LR+F GL V N +K FG I ++I L++ P+ C Sbjct: 240 LRLFTYGLIFVSNIFKEKLMVFGPIALNIALLVSVVNPIVYC 281 >SB_52311| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 506 Score = 28.3 bits (60), Expect = 7.0 Identities = 13/42 (30%), Positives = 21/42 (50%) Frame = -3 Query: 744 HNKLTTPNGYIQNVHQSLTTITDRKNITLSCL*NQYIHLTIT 619 HN + P+ Y H++ TI + + + +QY H TIT Sbjct: 215 HNTIAIPSQYHSQYHRNTITIPSQYHHNTIAIPSQYHHNTIT 256 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,507,044 Number of Sequences: 59808 Number of extensions: 385465 Number of successful extensions: 559 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 528 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 559 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 2034222073 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -