Bombyx BLAST Result against arabidopsis

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= an--0598
         (749 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At5g19670.1 68418.m02340 exostosin family protein contains Pfam ...    31   1.1  
At4g08920.1 68417.m01469 cryptochrome 1 apoprotein (CRY1) / flav...    28   5.8  
At1g04400.2 68414.m00431 cryptochrome 2 apoprotein (CRY2) / blue...    28   5.8  
At1g04400.1 68414.m00430 cryptochrome 2 apoprotein (CRY2) / blue...    28   5.8  

>At5g19670.1 68418.m02340 exostosin family protein contains Pfam
           domain, PF03016: Exostosin family
          Length = 600

 Score = 30.7 bits (66), Expect = 1.1
 Identities = 17/44 (38%), Positives = 23/44 (52%), Gaps = 1/44 (2%)
 Frame = +1

Query: 355 ITLRKTIENLCYI*-KRSRFPPIYGNYSFTNRFNELYGKVFKAY 483
           +T RK IEN      +R  +PPI+ N S   R  EL  ++ K Y
Sbjct: 231 LTARKEIENAPVAKLERELYPPIFRNVSLFKRSYELMERILKVY 274


>At4g08920.1 68417.m01469 cryptochrome 1 apoprotein (CRY1) /
           flavin-type blue-light photoreceptor (HY4) contains Pfam
           PF03441: FAD binding domain of DNA photolyase; member of
           Pfam PF00875: deoxyribodipyrimidine photolyase
           superfamily; 99% identical to Cryptochrome 1 apoprotein
           (Blue light photoreceptor) (flavin-type blue-light
           photoreceptor) (SP:Q43125) [Arabidopsis thaliana]
          Length = 681

 Score = 28.3 bits (60), Expect = 5.8
 Identities = 8/11 (72%), Positives = 8/11 (72%)
 Frame = -1

Query: 230 PWLWGSKYVWD 198
           PW WG KY WD
Sbjct: 376 PWRWGMKYFWD 386


>At1g04400.2 68414.m00431 cryptochrome 2 apoprotein (CRY2) / blue
           light photoreceptor (PHH1) 97% identical  to photolysase
           (PHH1)  (SP:Q96524) and cryptochrome 2 apoprotein (CRY2)
           (SP:U43397). ESTs gb|W43661 and gb|Z25638 come from this
           gene; contains Pfam profiles PF03441: FAD binding domain
           of DNA photolyase and PF00875: deoxyribodipyrimidine
           photolyase; identical to cDNA Cvi cryptochrome 2 (CRY2)
           GI:18026275
          Length = 612

 Score = 28.3 bits (60), Expect = 5.8
 Identities = 8/11 (72%), Positives = 8/11 (72%)
 Frame = -1

Query: 230 PWLWGSKYVWD 198
           PW WG KY WD
Sbjct: 373 PWKWGMKYFWD 383


>At1g04400.1 68414.m00430 cryptochrome 2 apoprotein (CRY2) / blue
           light photoreceptor (PHH1) 97% identical  to photolysase
           (PHH1)  (SP:Q96524) and cryptochrome 2 apoprotein (CRY2)
           (SP:U43397). ESTs gb|W43661 and gb|Z25638 come from this
           gene; contains Pfam profiles PF03441: FAD binding domain
           of DNA photolyase and PF00875: deoxyribodipyrimidine
           photolyase; identical to cDNA Cvi cryptochrome 2 (CRY2)
           GI:18026275
          Length = 612

 Score = 28.3 bits (60), Expect = 5.8
 Identities = 8/11 (72%), Positives = 8/11 (72%)
 Frame = -1

Query: 230 PWLWGSKYVWD 198
           PW WG KY WD
Sbjct: 373 PWKWGMKYFWD 383


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 14,469,428
Number of Sequences: 28952
Number of extensions: 280074
Number of successful extensions: 459
Number of sequences better than 10.0: 4
Number of HSP's better than 10.0 without gapping: 451
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 459
length of database: 12,070,560
effective HSP length: 79
effective length of database: 9,783,352
effective search space used: 1663169840
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)