BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0594 (691 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC32H8.08c |||mannosyltransferase complex subunit |Schizosacch... 29 0.63 SPAC25G10.03 |zip1||transcription factor Zip1|Schizosaccharomyce... 27 1.9 >SPBC32H8.08c |||mannosyltransferase complex subunit |Schizosaccharomyces pombe|chr 2|||Manual Length = 438 Score = 29.1 bits (62), Expect = 0.63 Identities = 13/50 (26%), Positives = 22/50 (44%), Gaps = 4/50 (8%) Frame = +3 Query: 471 PPSNGSSGD----SHDYGAFDFKRKDFFGQRKQREFIPDSKKDDGYWDRR 608 PP N G H + F+ R DF+ ++ E++ + G+W R Sbjct: 315 PPLNRIDGQIYNLCHFWSNFEIARLDFYNSKEYNEYVDALENAGGFWTER 364 >SPAC25G10.03 |zip1||transcription factor Zip1|Schizosaccharomyces pombe|chr 1|||Manual Length = 330 Score = 27.5 bits (58), Expect = 1.9 Identities = 12/30 (40%), Positives = 18/30 (60%) Frame = +3 Query: 600 DRRRRNNEAAKRSREKRRFNDMVLEQRVVE 689 D+RRRN A+ R R K++ + LE+ E Sbjct: 269 DKRRRNTAASARFRIKKKLKEQQLERTAKE 298 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,386,122 Number of Sequences: 5004 Number of extensions: 40655 Number of successful extensions: 109 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 108 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 109 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 319939482 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -