BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0591 (585 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC9E9.02 |||dubious|Schizosaccharomyces pombe|chr 1|||Manual 26 3.5 SPBC354.08c |||DUF221 family protein|Schizosaccharomyces pombe|c... 26 4.7 >SPAC9E9.02 |||dubious|Schizosaccharomyces pombe|chr 1|||Manual Length = 98 Score = 26.2 bits (55), Expect = 3.5 Identities = 12/36 (33%), Positives = 23/36 (63%) Frame = -3 Query: 112 CNFNVPLFYLKRILNFSLALQRALNSSFDINLITSL 5 CNF+ LF+L++ + S+ L+ + +S+ I + SL Sbjct: 52 CNFSKSLFWLRKKIKNSVLLKTSFDSNETIFFLYSL 87 >SPBC354.08c |||DUF221 family protein|Schizosaccharomyces pombe|chr 2|||Manual Length = 865 Score = 25.8 bits (54), Expect = 4.7 Identities = 8/32 (25%), Positives = 17/32 (53%) Frame = +2 Query: 101 IKIAITVLLSIFPLCVLLKIKNRLQIFTLCIP 196 + + + LLS+ LC+ ++ + + CIP Sbjct: 34 VSLGFSSLLSVILLCIFTLLRTKFNTYDRCIP 65 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,835,948 Number of Sequences: 5004 Number of extensions: 31238 Number of successful extensions: 61 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 60 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 61 length of database: 2,362,478 effective HSP length: 69 effective length of database: 2,017,202 effective search space used: 252150250 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -