BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0591 (585 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 07_03_1475 + 26791214-26791490,26793507-26793706,26793866-267945... 27 8.3 >07_03_1475 + 26791214-26791490,26793507-26793706,26793866-26794507, 26794888-26795038,26795434-26795583,26795675-26795847, 26796088-26796195 Length = 566 Score = 27.5 bits (58), Expect = 8.3 Identities = 16/37 (43%), Positives = 19/37 (51%) Frame = -3 Query: 121 NSYCNFNVPLFYLKRILNFSLALQRALNSSFDINLIT 11 N C FN P +LK+ +NF L A S INL T Sbjct: 455 NDACQFN-PNRFLKKEINFEEILAAAHKGSNGINLFT 490 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,701,182 Number of Sequences: 37544 Number of extensions: 140344 Number of successful extensions: 184 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 183 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 184 length of database: 14,793,348 effective HSP length: 78 effective length of database: 11,864,916 effective search space used: 1376330256 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -